CAZyme Information: TRIVIDRAFT_90504-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_90504-t45_1-p1
• CAZy Family: GT57
• CAZyme Description: glycoside hydrolase family 7 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
505	ABDF02000078|CGC1	53083.30	4.7278

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000078:482924-484562(+)

Full Sequence      

MYQKLAAISAFLAAARAQQVCTQQAETHPPLTWQKCSSSGCTAQSGSVVLDANWRWTHDV
KSTTNCYDGNTWSKTLCPDDATCAKNCCLDGAAYSSTYGITTSSDSLTINFVTQSNVGAR
LYLMATDTSYQEFTLSGNEFSFDVDVSQLPCGLNGALYFVSMDADGGQSKYPTNAAGAKY
GTGYCDSQCPRDLKFINGQANVDGWQPSSNNANTGIGGHGSCCSEMDIWEANSISQAVTP
HPCETVGQTMCSGDGCGGTYSSDRYGGTCDPDGCDWNPYRLGNTTFYGPGSGFTLDTTKK
MTVVTQFATSGAISRYYVQNGVKFQQPNAQLSGYSGNTLNSDYCAAEQAAFGGTSFTDKG
GLAQFNKALSGGMVLVMSLWDDYYANMLWLDSTYPTNATASTPGAKRGSCSTSSGVPSQI
ESQSPNAKVVFSNIRFGPIGSTGGSTGNPPPGTSTTRLPPSSTGSSPGPTQTHYGQCGGI
GYSGPTQCVSGTTCQVLNPYYSQCL

Enzyme Prediction     

EC	3.2.1.176:83	3.2.1.132:6	3.2.1.4:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH7	19	442	6.3e-184	0.9927710843373494

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
153432	GH7_CBH_EG	0.0	25	437	1	386	Glycosyl hydrolase family 7. Glycosyl hydrolase family 7 contains eukaryotic endoglucanases (EGs) and cellobiohydrolases (CBHs) that hydrolyze glycosidic bonds using a double-displacement mechanism. This leads to a net retention of the conformation at the anomeric carbon. Both enzymes work synergistically in the degradation of cellulose,which is the main component of plant cell wall, and is composed of beta-1,4 linked glycosyl units. EG cleaves the beta-1,4 linkages of cellulose and CBH cleaves off cellobiose disaccharide units from the reducing end of the chain. In general, the O-glycosyl hydrolases are a widespread group of enzymes that hydrolyze the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycoside hydrolase family 7.
395677	Glyco_hydro_7	0.0	20	442	1	434	Glycosyl hydrolase family 7.
395595	CBM_1	1.70e-11	473	501	1	29	Fungal cellulose binding domain.
197593	fCBD	2.09e-11	472	505	1	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ57077.1|CBM1|GH7	0.0	1	505	1	505
UKZ82808.1|CBM1|GH7	0.0	1	505	1	505
ACF93800.1|CBM1|GH7|3.2.1.176	0.0	1	505	1	505
AAF36391.1|CBM1|GH7|3.2.1.176	0.0	1	505	1	505
ADH04808.1|CBM1|GH7	0.0	1	505	1	505

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Y9N_A	1.82e-283	19	448	2	431	Cellobiohydrolase I Cel7A from Trichoderma harzianum at 2.9 A resolution [Trichoderma harzianum]
2YOK_A	2.80e-281	19	443	2	426	Cellobiohydrolase I Cel7A from Trichoderma harzianum at 1.7 A resolution [Trichoderma harzianum]
1CEL_A	5.18e-265	21	447	4	434	Chain A, 1,4-BETA-D-GLUCAN CELLOBIOHYDROLASE I [Trichoderma reesei],1CEL_B Chain B, 1,4-BETA-D-GLUCAN CELLOBIOHYDROLASE I [Trichoderma reesei],1DY4_A CBH1 IN COMPLEX WITH S-PROPRANOLOL [Trichoderma reesei QM9414],2V3I_A Chain A, EXOGLUCANASE 1 [Trichoderma reesei],2V3R_A Chain A, EXOGLUCANASE 1 [Trichoderma reesei],4P1J_A Chain A, Exoglucanase 1 [Trichoderma reesei],6GRN_A Chain A, Exoglucanase 1 [Trichoderma reesei]
4P1H_A	9.69e-265	21	443	4	430	Crystal structure of wild type Hypocrea jecorina Cel7a in a monoclinic crystal form [Trichoderma reesei QM6a],5TC9_A Wild type TrCel7A catalytic domain in a closed state [Trichoderma reesei QM6a]
2CEL_A	1.04e-264	21	447	4	434	Chain A, 1,4-BETA-D-GLUCAN CELLOBIOHYDROLASE I [Trichoderma reesei],2CEL_B Chain B, 1,4-BETA-D-GLUCAN CELLOBIOHYDROLASE I [Trichoderma reesei],3CEL_A Chain A, 1,4-BETA-D-GLUCAN CELLOBIOHYDROLASE I [Trichoderma reesei],4D5I_A Hypocrea jecorina cellobiohydrolase Cel7A E212Q soaked with xylotriose. [Trichoderma reesei QM9414],4D5O_A Chain A, CELLULOSE 1,4-BETA-CELLOBIOSIDASE [Trichoderma reesei],4UWT_A Hypocrea jecorina Cel7A E212Q mutant in complex with p-nitrophenyl cellobioside [Trichoderma reesei QM9414],5CEL_A Chain A, 1,4-BETA-D-GLUCAN CELLOBIOHYDROLASE I [Trichoderma reesei],6CEL_A Chain A, 1,4-BETA-D-GLUCAN CELLOBIOHYDROLASE I [Trichoderma reesei],7NYT_A Chain A, Exoglucanase 1 [Trichoderma reesei],7OC8_A Chain A, Exoglucanase 1 [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9P8P3|GUX1_TRIHA	0.0	1	505	1	505	Exoglucanase 1 OS=Trichoderma harzianum OX=5544 GN=cbh1 PE=1 SV=1
sp|P62695|GUX1_TRIKO	7.30e-307	1	505	1	513	Exoglucanase 1 OS=Trichoderma koningii OX=97093 GN=cbh1 PE=3 SV=1
sp|P62694|GUX1_HYPJE	7.30e-307	1	505	1	513	Exoglucanase 1 OS=Hypocrea jecorina OX=51453 GN=cbh1 PE=1 SV=1
sp|P19355|GUX1_HYPRU	7.58e-307	1	505	1	514	Exoglucanase 1 OS=Hypocrea rufa OX=5547 GN=cbh1 PE=3 SV=2
sp|A0A024RXP8|GUX1_HYPJR	1.78e-305	1	505	1	514	Exoglucanase 1 OS=Hypocrea jecorina (strain ATCC 56765 / BCRC 32924 / NRRL 11460 / Rut C-30) OX=1344414 GN=cbh1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000261	0.999706	CS pos: 17-18. Pr: 0.9699

TMHMM  Annotations     

There is no transmembrane helices in TRIVIDRAFT_90504-t45_1-p1.