CAZyme Information: TRIVIDRAFT_89619-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_89619-t45_1-p1
• CAZy Family: GT4
• CAZyme Description: glycosyltransferase family 32 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
352		39581.92	6.4089

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000083:612913-614057(-)

Full Sequence      

MLLHEKADPFSPLRQILHHVSQRRYRNYAAVGIALVLLSMVWLSGSLTLHSSRQKWHDDF
ANTRVPEWASRASKANDSRLIPANIWQIVLPKTQPFLGDPNHVHVDVRQLEHTASWIAMN
PDWQYTLVGQKGGDEFVDSSFAHNPKIAEVYHNISNVGQKSDLLRYLLLGVHGGVYTDTD
TLALKPVDAWVPEALRNKARLIVGIEFDRRDGGPWADIPHWLQFCQWTIAAAPGHPVFNK
MVDRVLHSLDDLSALHGLPISQLKPESFEVMNSTGPAAWTDVVFEQLQEYNPQLTDTKDL
SFMSEPTLIGDILILPIDGFGMGQDHSASTNDGSIPPTAMMRHMFHGSWRGE

Enzyme Prediction     

No EC number prediction in TRIVIDRAFT_89619-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	112	193	5.7e-18	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.35e-22	50	349	53	344	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	5.31e-16	115	193	10	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
368570	Caps_synth	0.009	161	246	114	189	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ83874.1|GT32	2.46e-271	1	352	1	352
UKZ58174.1|GT32	1.20e-257	1	337	1	337
QYT06191.1|GT32	7.40e-232	1	352	1	352
UKZ69802.1|GT32	7.38e-198	1	352	1	353
UKZ94407.1|GT32	1.42e-195	1	352	1	354

PDB Hits     

TRIVIDRAFT_89619-t45_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	3.43e-41	81	352	142	396	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	1.45e-40	76	352	94	378	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	1.12e-27	81	350	96	470	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P47124|HOC1_YEAST	3.26e-24	116	316	154	357	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999970	0.000040

TMHMM  Annotations     

Start	End
28	50