CAZyme Information: TRIVIDRAFT_88883-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_88883-t45_1-p1
• CAZy Family: GT39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
583	ABDF02000085|CGC9	64664.51	5.3793

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000085:317955-319706(+)

Full Sequence      

MPSTAPINSGDRFDFIVVGGGTAGNTVAGRLAENPNVRILIVEAGVANPDQLKEVMTPSN
AMNLRGSKHDWAYKTTIVKRDDYERIEKPNTRGKILGGSSSLNYFTWIPGCKPTFDMWAE
YGGEEWTWDPLVPYLRKSVTYHDDEGLYDPELAKIGTGGPINVSHAELLPEMAPFRDALT
KAWTSMGEPLTENIYDGEMIGLYHCADTIYKGQRNGSFLFLKNKPNITVLTEVHSKKLLI
DYADRTCRGVTVVGADGKELSFYADREVILSQGVYGSPQLLMLSGIGPARELAKHNIECI
VDSRHVGQNLIDHPAVPFVLRVKDEFGMDNTILRKNEANAQAHAAYDKDHSGPVGSGFLE
MVGFPRIDKYLAKDPIYSKAVADNGGKDPLCPDGQPHFELDFVSIFGSAFQWHYPIPKVG
AHTTVVVDLVRPISKPGEVTLNSANYLDNPNINLNFFESELDIIAMREGIRFSYDLLTKG
EGFKDLVVDEYPWDMPLDNDDEMRRVVLDRCQTAFHPCGSARLSKNIEQGVVDPALKVHG
VKNLRLIDASIMPVIPDCRIQNSVYMVGEKGADLIKASHKDLY

Enzyme Prediction     

No EC number prediction in TRIVIDRAFT_88883-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	12	577	3.8e-147	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	6.24e-87	12	576	5	532	choline dehydrogenase; Validated
225186	BetA	1.43e-84	8	580	3	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	7.47e-37	432	570	1	142	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	5.94e-28	2	568	45	569	Protein HOTHEAD
366272	GMC_oxred_N	2.96e-21	92	315	23	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYT04257.1|AA3_2	0.0	1	583	1	583
UKZ95187.1|AA3_2	0.0	1	583	1	583
UKZ78908.1|AA3_2	0.0	7	583	3	579
UKZ53071.1|AA3	0.0	7	583	3	579
BCR85434.1|AA3_2	0.0	7	583	2	578

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5ZU2_A	0.0	10	583	4	577	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	0.0	10	583	4	577	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
3Q9T_A	0.0	10	583	4	577	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5OC1_A	1.18e-72	13	577	2	563	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	6.42e-72	13	577	3	564	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q988C9|4PADH_RHILO	4.84e-60	11	578	5	536	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|A0A3B1EFP9|STR4_STRTC	2.58e-57	13	576	36	612	Dehydrogenase str4 OS=Strobilurus tenacellus OX=41251 GN=str4 PE=1 SV=1
sp|Q0R4L2|PDH3_LEUMG	2.75e-57	13	579	41	599	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1
sp|V5NC32|PDH1_AGAXA	5.27e-57	2	579	32	599	Pyranose dehydrogenase OS=Agaricus xanthodermus OX=83518 GN=pdh1 PE=1 SV=1
sp|Q47944|SDH_GLUOY	2.70e-56	13	578	5	530	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000001	0.000033

TMHMM  Annotations     

There is no transmembrane helices in TRIVIDRAFT_88883-t45_1-p1.