CAZyme Information: TRIVIDRAFT_87418-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_87418-t45_1-p1
• CAZy Family: GT33
• CAZyme Description: glycoside hydrolase family 75 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
235		24050.69	5.1924

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000091:1712918-1713744(-)

Full Sequence      

MRSDALLGLATFGAVASAFSLPANLKTIYNNHKSGTCSKKLSGSFSGGASYCGDIAGAIF
LKGSAGNYDNLDIDCDGANNSAGACANDPSGQSQTAFKDTVRSFGISDLDANIHPYVVFG
NEGGNPSFNPKSAGMQPLSVMAVVCNNQVFYGIWGDTNGGTSTGEASLALGKLCFPNEGL
SGDNGHDPKDVLFIGFTDPAAVPGKSGAKWTAKNTNDFENSIKALGDRLVAGLKA

Enzyme Prediction     

EC	3.2.1.132:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH75	11	231	4.1e-85	0.9636363636363636

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399960	Glyco_hydro_75	1.15e-98	71	231	1	164	Fungal chitosanase of glycosyl hydrolase group 75. This family consists of several fungal chitosanase proteins. Chitin, xylan, 6-O-sulphated chitosan and O-carboxymethyl chitin are indigestible by chitosanase. EC:3.2.1.132. The mechanism is likely to be inverting, and the probable catalytic neutrophile base is Asp, with the probable catalytic proton donor being Glu. (see the Chitosanase web-page from CAZY).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ55925.1|GH75	1.58e-172	1	235	1	235
UKZ81671.1|GH75	4.52e-172	1	235	1	235
AAS77607.1|GH75	4.12e-159	1	235	1	235
QYT03532.1|GH75	4.12e-159	1	235	1	235
UKZ68186.1|GH75	2.36e-151	1	235	1	234

PDB Hits     

TRIVIDRAFT_87418-t45_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WB37|CSN_ASPFU	2.56e-111	15	235	15	242	Endo-chitosanase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=csn PE=3 SV=1
sp|Q875I9|CSN_ASPFM	2.71e-105	16	235	15	238	Endo-chitosanase OS=Neosartorya fumigata OX=746128 GN=csn PE=1 SV=1
sp|Q2U1H5|CSNB_ASPOR	3.12e-100	1	235	1	241	Endo-chitosanase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csnB PE=3 SV=1
sp|Q2U3M5|CSN_ASPOR	4.53e-96	16	235	15	245	Endo-chitosanase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csn PE=3 SV=1
sp|Q9P961|CSN_ASPOZ	4.53e-96	16	235	15	245	Endo-chitosanase OS=Aspergillus oryzae OX=5062 GN=csn PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000341	0.999629	CS pos: 20-21. Pr: 0.7017

TMHMM  Annotations     

There is no transmembrane helices in TRIVIDRAFT_87418-t45_1-p1.