CAZyme Information: TRIVIDRAFT_86342-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_86342-t45_1-p1
• CAZy Family: GT32
• CAZyme Description: glycoside hydrolase family 47 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
568	ABDF02000002|CGC6	64681.75	5.2939

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000002:1304984-1306753(-)

Full Sequence      

MLNQIQGRVPRRYVALVVFFAFVALFLWRGFDVVPRPSTVGRFKYVPSSYDWSKAKVYHP
VKGMKGLPQGTPVTFPKVQLRKHSETEDATSNARKQAVKKAFIKSWEAYKTHAWGMDQLQ
PLSGNGKETFSGWSAQIVDALDTLWIMDLKEDFFLAVKEVAVIDWATTKDSNTINLFEVT
IRYLGGLLAAYDLSQEPVLRAKAIELGDALYATFDTPNRLPSHWLDYSKAKKGEQTADDS
MSGAAGGTLCMEFTRLSQITGDPKYYDATERIKQFYYRFQNETSLPGLWPVTMNFRDEQI
IETRYTIGAGADSMYEYLVKMPVLLGGLDPQYPEMAIKALDTARDHLLYRPMTPKDENIL
MAGNALVDHGNIQRFYEMQHLTCFAGGMYAMAGKLYKRDDYVDIGSRLSSGCVWAYNSFA
SGIMPEAADLAGCKSLDGPCPYDETLAPLSHDPRIPPGFLDIKSRHYLLRPEAIESVFYM
YRITGDQVWRDTAWQLWENIIRETETELAFAIVEDVTVSRGTNGDVMETFWLAETLKYFY
LIFDDESVIDLDEWVFNTEAHPFKRPRV

Enzyme Prediction     

EC	3.2.1.113:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	101	565	2.7e-156	0.9977578475336323

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	0.0	101	565	1	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	2.30e-119	68	566	50	519	glycoside hydrolase family 47 protein; Provisional
271200	LanM-like	0.005	184	350	598	749	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ46500.1|GH47	0.0	1	568	1	568
UKZ73085.1|GH47	0.0	1	568	1	568
QYS94506.1|GH47	0.0	3	568	6	571
UKZ92119.1|GH47	1.08e-303	1	566	1	567
UNI15842.1|GH47	3.11e-280	3	566	4	577

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1KKT_A	5.92e-74	70	567	16	510	Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KKT_B Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KRE_A Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRE_B Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_A Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_B Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum]
2RI8_A	6.92e-73	90	567	1	475	Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI8_B Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI9_A Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum],2RI9_B Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum]
5KKB_A	8.78e-72	85	563	13	465	Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus],5KKB_B Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus]
1NXC_A	1.11e-71	85	563	11	463	Structure of mouse Golgi alpha-1,2-mannosidase IA reveals the molecular basis for substrate specificity among Class I enzymes (family 47 glycosidases) [Mus musculus]
5KIJ_A	1.37e-67	92	562	3	448	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|E9CXX8|MNS1B_COCPS	9.16e-75	84	564	35	513	Mannosyl-oligosaccharide alpha-1,2-mannosidase OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) OX=443226 GN=CPSG_02648 PE=1 SV=1
sp|D4AV26|MNS1B_ARTBC	7.54e-74	71	564	15	506	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase ARB_00035 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00035 PE=1 SV=1
sp|P31723|MAN12_PENCI	3.05e-73	70	567	16	510	Mannosyl-oligosaccharide alpha-1,2-mannosidase OS=Penicillium citrinum OX=5077 GN=MSDC PE=1 SV=2
sp|A2QAS2|MNS1B_ASPNC	1.72e-72	86	564	34	509	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mns1B PE=3 SV=1
sp|Q12563|MNS1B_ASPPH	3.54e-71	83	564	33	509	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus phoenicis OX=5063 GN=mns1B PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000033	0.000000

TMHMM  Annotations     

Start	End
13	35