CAZyme Information: TRIVIDRAFT_85551-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_85551-t45_1-p1
• CAZy Family: GT32
• CAZyme Description: glycoside hydrolase family 18 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
411	ABDF02000001|CGC13	42738.46	4.4286

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000001:182315-183868(+)

Full Sequence      

MFFSKVTLGAGLLASLASAAPSPIARRQAPGAQNVVYWGQNGGSTVENNDLSAYCTPTSD
IDIIVLSFLYQWGQGASALGGTIGQSCGITTSGQPQNCDALTAAITKCKNAGVKIILSLG
GASAYSSFSSADQASQAGQYLWNAYGGGSGVTRPLGNNIMDGWDLDIESNPGTNQYYASL
VNTLRSNFASDPAHKYVITGAPQCPLPEPNMGVIIQNSVFDYLWVQFYNNNDYPADPCSL
GLPGDAPFNYNNWTTFLQTTPSKNAKLFIGVPAAPLAANGGPGGAVYYATPSQLATIVND
VKGESNFGGIMMWSAGFSDSNVNDGCNYAQEAKHILLTGSPCSSGPVSVSQPSVPTSTTT
SKPPGSSQTPPPSSGSVPQWGQCGGNGYTGPTQCIAPFKCVATSEWWSQCE

Enzyme Prediction     

EC	3.2.1.14:1	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	34	328	5.5e-24	0.9628378378378378

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119356	GH18_hevamine_XipI_class_III	3.76e-96	32	333	1	279	This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain. Hevamine is a class III endochitinase that hydrolyzes the linear polysaccharide chains of chitin and peptidoglycan and is important for defense against pathogenic bacteria and fungi. PPL2 (Parkia platycephala lectin 2) is a class III chitinase from Parkia platycephala seeds that hydrolyzes beta(1-4) glycosidic bonds linking 2-acetoamido-2-deoxy-beta-D-glucopyranose units in chitin.
395573	Glyco_hydro_18	1.10e-15	35	317	3	306	Glycosyl hydrolases family 18.
119349	GH18_chitinase-like	1.53e-10	38	316	8	208	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
119350	GH18_chitinase_D-like	2.50e-10	58	324	25	304	GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.
197593	fCBD	3.04e-10	378	410	1	33	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ57234.1|CBM1|GH18	1.40e-295	1	411	1	409
UKZ82959.1|CBM1|GH18	1.21e-281	1	411	1	404
QYT05100.1|CBM1|GH18	1.97e-262	1	411	1	414
UFI07897.1|CBM1|GH18	1.91e-253	1	411	1	414
UKZ61442.1|CBM1|GH18	1.75e-229	1	411	1	408

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2UY2_A	1.33e-53	36	340	10	291	ScCTS1_apo crystal structure [Saccharomyces cerevisiae],2UY3_A ScCTS1_8-chlorotheophylline crystal structure [Saccharomyces cerevisiae],2UY4_A ScCTS1_acetazolamide crystal structure [Saccharomyces cerevisiae],2UY5_A ScCTS1_kinetin crystal structure [Saccharomyces cerevisiae],4TXE_A ScCTS1 in complex with compound 5 [Saccharomyces cerevisiae]
2XVN_A	3.17e-46	36	337	5	308	A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus],2XVN_B A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus],2XVN_C A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus]
2XTK_A	3.25e-46	36	337	6	309	ChiA1 from Aspergillus fumigatus in complex with acetazolamide [Aspergillus fumigatus A1163],2XTK_B ChiA1 from Aspergillus fumigatus in complex with acetazolamide [Aspergillus fumigatus A1163],2XUC_A Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XUC_B Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XUC_C Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XVP_A ChiA1 from Aspergillus fumigatus, apostructure [Aspergillus fumigatus A1163],2XVP_B ChiA1 from Aspergillus fumigatus, apostructure [Aspergillus fumigatus A1163]
4TX6_A	3.25e-46	36	337	6	309	AfChiA1 in complex with compound 1 [Aspergillus fumigatus A1163],4TX6_B AfChiA1 in complex with compound 1 [Aspergillus fumigatus A1163]
1HVQ_A	4.38e-41	36	321	5	263	CRYSTAL STRUCTURES OF HEVAMINE, A PLANT DEFENCE PROTEIN WITH CHITINASE AND LYSOZYME ACTIVITY, AND ITS COMPLEX WITH AN INHIBITOR [Hevea brasiliensis],1LLO_A Chain A, HEVAMINE [Hevea brasiliensis],2HVM_A Hevamine A At 1.8 Angstrom Resolution [Hevea brasiliensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|E9F9R9|CHI2_METRA	1.38e-172	1	410	1	418	Endochitinase 2 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=chi2 PE=3 SV=2
sp|Q4U4T0|CHI2_METAN	5.60e-172	1	410	1	418	Endochitinase 2 OS=Metarhizium anisopliae OX=5530 GN=chi2 PE=1 SV=1
sp|P29029|CHIT_YEAST	2.60e-50	36	340	31	312	Endochitinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CTS1 PE=1 SV=2
sp|P29026|CHI1_RHIOL	4.85e-48	4	315	3	294	Chitinase 1 OS=Rhizopus oligosporus OX=4847 GN=CHI1 PE=1 SV=1
sp|P40953|CHI2_CANAL	1.81e-47	1	336	1	302	Chitinase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CHT2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000992	0.998969	CS pos: 27-28. Pr: 0.8921

TMHMM  Annotations     

There is no transmembrane helices in TRIVIDRAFT_85551-t45_1-p1.