CAZyme Information: TRIVIDRAFT_8282-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_8282-t45_1-p1
• CAZy Family: GT31
• CAZyme Description: glycoside hydrolase family 11 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
231		24630.09	6.4814

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000065:66167-66955(-)

Full Sequence      

MVAFSRIVAGLSVIAASLAAPTDPAEKKVETRDAYNFFLGPDHPLSRRSVTRRSNTNYNQ
DYTTGGTVNFTPATNGFSLNWNTQQDFVVGVGWNPGSNLPITHSGTFNVASGLGSLGVYG
WTTNPLVEYYIMDTNVGISTGGSQKGTVSSDGGTYAIWENTRVNEPSIIGTATFNQYISI
RNGARTNGTITVQNHFDAWAAAGLHLGTMNYQVIAVESWSGSGSAQQSVSN

Enzyme Prediction     

EC	3.2.1.8:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH11	59	226	4.8e-57	0.96045197740113

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395367	Glyco_hydro_11	3.05e-82	55	225	1	174	Glycosyl hydrolases family 11.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ81589.1|CBM1|GH11	3.30e-165	1	231	1	231
UKZ55831.1|CBM1|GH11	3.30e-165	1	231	1	231
QYT00180.1|CBM1|GH11	1.67e-150	1	231	1	231
UKZ97157.1|CBM1|GH11	1.22e-131	1	231	1	226
EGX51488.1|CBM1|GH11	3.09e-107	1	221	1	224

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XYN_A	4.87e-87	57	231	4	178	Chain A, Endo-1,4-beta-xylanase I [Trichoderma reesei]
2VGD_A	3.21e-49	66	230	48	215	Crystal structure of environmental isolated GH11 in complex with xylobiose and feruloyl-arabino-xylotriose [Escherichia coli]
2VUJ_A	3.31e-49	66	230	48	215	Environmentally isolated GH11 xylanase [Escherichia coli]
2VUL_A	6.06e-49	66	231	48	216	Thermostable mutant of ENVIRONMENTALLY ISOLATED GH11 XYLANASE [Escherichia coli]
1TE1_B	8.97e-48	65	230	23	190	Crystal structure of family 11 xylanase in complex with inhibitor (XIP-I) [Talaromyces funiculosus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G0R947|XYN1_HYPJQ	4.32e-94	1	231	1	229	Endo-1,4-beta-xylanase 1 OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=TRIREDRAFT_74223 PE=1 SV=1
sp|P36218|XYN1_HYPJR	4.32e-94	1	231	1	229	Endo-1,4-beta-xylanase 1 OS=Hypocrea jecorina (strain ATCC 56765 / BCRC 32924 / NRRL 11460 / Rut C-30) OX=1344414 GN=xyn1 PE=1 SV=1
sp|Q8J0K5|XYNB_TALFU	7.17e-73	57	221	44	210	Endo-1,4-beta-xylanase B OS=Talaromyces funiculosus OX=28572 GN=xynB PE=1 SV=1
sp|Q0CFS3|XYNA_ASPTN	1.55e-57	1	229	1	230	Probable endo-1,4-beta-xylanase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=xlnA PE=3 SV=1
sp|B8NKE9|XYNA_ASPFN	2.94e-55	1	225	1	227	Probable endo-1,4-beta-xylanase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=xlnA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000881	0.999103	CS pos: 19-20. Pr: 0.9540

TMHMM  Annotations     

There is no transmembrane helices in TRIVIDRAFT_8282-t45_1-p1.