CAZyme Information: TRIVIDRAFT_81563-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_81563-t45_1-p1
• CAZy Family: GT2|GT2
• CAZyme Description: glycoside hydrolase family 55 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
764	ABDF02000069|CGC1	79961.73	5.4869

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000069:128729-131361(+)

Full Sequence      

MKSFSLLGSLALLTARSWALPTESPAATLQERQSGSSWFLPNIDHTTGAVRGYVPDLFDS
SGNQNFNYPVYKTVNSGDATGFVNAISSDGPSGGARDNCYLAGEPRVIYLPPGTYTVSST
IFFDTDTVVIGDAANPPTIKAASGFNGNYLIVGGQGDGSNHPCGGSGGETHFSVMIKNVI
LDTTAIASNSNFVALSWAVAQNCALVNVKINMPQGVHTGMLVNGGSTISISDVHFSFGNI
GLHWNGHQQGQIKGMSFTDCTNGIYIDGGNTISIFAPTCNTVGRCIVLNSGNPWVAVIDG
ISQNSGDFFTSIPSFPNFMIENISKDTTNSNMVVVGGAVKVGGVTSIGTYVWGNTRGTNP
IYQTNPTAQAVNRPAALAPGGRYPVINAPQYADKTVANVVNLKDPNQNGGHTLQGDGFTD
DTASLQAALNTAASQGKIAYLPFGIYIVTSTITIPPGTELYGEAWSTISGSGSAFASETN
PTPVVQIGSTPGQKGVAHIQDIRFTVNQPLAGAILLRVNMAGNNPGDVAVFNSLNTIGGT
RDTSINCSNESNCKAAYLGLHLAAGSSAYIDNFWSWVADHPSDQSNKGIRSAVKGGVLVE
ATAGTWLTGLGSEHNWLFQLSFHNAANVFISLFQSETNYNQGNNGAPLVGSPFNALSSDP
NFSWCNGGDTVCRMGLAQYYTGSNSNIFHYAAGSWNFIGLTQVNQGIMNYIQTAVTGAHL
YGFTAGPNVAETMRLPNGNEFGNGGSDGYGGSWQTLIANIASQS

Enzyme Prediction     

No EC number prediction in TRIVIDRAFT_81563-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH55	28	726	2.4e-161	0.95

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403800	Pectate_lyase_3	6.72e-27	103	274	32	200	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
403800	Pectate_lyase_3	1.57e-05	415	473	11	73	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ54446.1|GH55	0.0	1	764	1	725
UKZ80224.1|GH55	0.0	1	764	1	725
QYT01722.1|GH55	0.0	1	764	1	763
UKZ86438.1|GH55	0.0	1	764	1	762
UKZ58708.1|GH55	0.0	1	763	1	760

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3EQN_A	1.06e-74	35	661	23	662	Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQN_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_A Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium]
5M5Z_A	5.35e-68	36	697	4	688	Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila],5M60_A Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P53626|E13B_TRIHA	6.14e-185	11	753	9	750	Glucan endo-1,3-beta-glucosidase BGN13.1 OS=Trichoderma harzianum OX=5544 GN=bgn13.1 PE=1 SV=1
sp|P49426|EXG1_COCCA	1.47e-65	1	663	1	686	Glucan 1,3-beta-glucosidase OS=Cochliobolus carbonum OX=5017 GN=EXG1 PE=1 SV=1
sp|D4B0V1|E13B_ARTBC	4.83e-58	1	740	5	854	Probable glucan endo-1,3-beta-glucosidase ARB_02077 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02077 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000337	0.999642	CS pos: 32-33. Pr: 0.2464

TMHMM  Annotations     

There is no transmembrane helices in TRIVIDRAFT_81563-t45_1-p1.