CAZyme Information: TRIVIDRAFT_79686-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_79686-t45_1-p1
• CAZy Family: GT22
• CAZyme Description: glycoside hydrolase family 16 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375		40725.02	4.7774

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000002:796238-797607(-)

Full Sequence      

MERSSVKPGEIPSRYQEFAVGSGGDYQRSGSSAPAWDPRYWSKKVWIGIAVVIVIAIIIG
VAVGVTQGKKSSYPDYSQLSYTLKDTFQGETFFDNFNYFTGFDPAGGFVHYVDAGRAQQL
NLTFASQDAAVLKVDTSVGPGSNPDASTGRFSVRLESKNTYNNGLFIFDVRHTPFGCGTW
PALWLTDPSNWPKNGEIDVMEATNKASDGNQMTLHTSSDCSMSVKRKQTDKALQTNCDAT
KNSNAGCGVQGADNTFGSAYNNNGGGIMAMEWRDAGIRVWQFARNSIPSDITGQKPDPST
WGEAAADFPSTDCDVASHFKNNSIILNIDLCGDLVYGVWDSSGCSSNCTDIVANNPQSFT
NAYWEVGKFQVYQAL

Enzyme Prediction     

No EC number prediction in TRIVIDRAFT_79686-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	121	352	1.6e-89	0.982532751091703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185690	GH16_fungal_Lam16A_glucanase	1.32e-138	80	373	1	293	fungal 1,3(4)-beta-D-glucanases, similar to Phanerochaete chrysosporium laminarinase 16A. Group of fungal 1,3(4)-beta-D-glucanases, similar to Phanerochaete chrysosporium laminarinase 16A. Lam16A belongs to the 'nonspecific' 1,3(4)-beta-glucanase subfamily, although beta-1,6 branching and beta-1,4 bonds specifically define where Lam16A hydrolyzes its substrates, like curdlan (beta-1,3-glucan), lichenin (beta-1,3-1,4-mixed linkage glucan), and laminarin (beta-1,6-branched-1,3-glucan).
185693	GH16_laminarinase_like	5.57e-10	174	342	89	221	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185691	GH16_Strep_laminarinase_like	5.07e-05	178	215	106	148	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
185694	GH16_CCF	0.009	180	210	130	159	Coelomic cytolytic factor, member of glycosyl hydrolase family 16. Subgroup of glucanases of unknown function that are related to beta-GRP (beta-1,3-glucan recognition protein), but contain active site residues. Beta-GRPs are one group of pattern recognition receptors (PRRs), also referred to as biosensor proteins, that complexes with pathogen-associated beta-1,3-glucans and then transduces signals necessary for activation of an appropriate innate immune response. Beta-GRPs are present in insects and lack all catalytic residues. This subgroup contains related proteins that still contain the active site and are widely distributed in eukaryotes. Their structures adopt a jelly roll fold with a deep active site channel harboring the catalytic residues, like those of other glycosyl hydrolase family 16 members.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ72924.1|GH16_1	1.97e-275	1	375	1	375
UKZ46342.1|GH16_1	5.42e-273	1	375	1	375
QYS94870.1|GH16_1	4.93e-246	6	374	5	373
UKZ93838.1|GH16_1	2.34e-217	6	374	4	366
UKZ70373.1|GH16_1	1.12e-208	6	374	4	414

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2CL2_A	1.41e-80	80	373	2	298	Chain A, PUTATIVE LAMINARINASE [Phanerodontia chrysosporium],2W39_A Chain A, Putative Laminarinase [Phanerodontia chrysosporium],2W52_A Chain A, PUTATIVE LAMINARINASE [Phanerodontia chrysosporium]
2WLQ_A	7.95e-80	80	373	2	298	Chain A, PUTATIVE LAMINARINASE [Phanerodontia chrysosporium],2WNE_A Chain A, PUTATIVE LAMINARINASE [Phanerodontia chrysosporium]
3WDU_A	3.43e-66	81	372	2	295	The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila'],3WDU_B The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila'],3WDU_C The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila'],3WDU_D The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila']
3WDT_A	3.53e-66	81	372	3	296	The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDT_B The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDT_C The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDT_D The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDV_A The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDV_B The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDV_C The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDV_D The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila']
3WDY_A	2.62e-65	81	372	1	294	The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDY_B The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDY_C The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDY_D The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila']

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9USW3|YHZ7_SCHPO	1.96e-84	70	373	118	418	Probable glycosidase C21B10.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC21B10.07 PE=3 SV=1
sp|D4AJR9|EGLX_ARTBC	2.43e-64	80	373	19	315	Endo-1,3(4)-beta-glucanase ARB_04519 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_04519 PE=3 SV=1
sp|A1C7B5|EGLX_ASPCL	5.51e-63	80	373	32	328	Probable endo-1,3(4)-beta-glucanase ACLA_073210 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=ACLA_073210 PE=3 SV=1
sp|Q2UIE6|EGLX_ASPOR	1.23e-62	75	373	25	326	Probable endo-1,3(4)-beta-glucanase AO090023000083 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090023000083 PE=3 SV=1
sp|B8N7S7|EGLX_ASPFN	1.75e-61	75	373	25	326	Probable endo-1,3(4)-beta-glucanase AFLA_105200 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=AFLA_105200 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999976	0.000048

TMHMM  Annotations     

Start	End
45	67