CAZyme Information: TRIVIDRAFT_77255-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_77255-t45_1-p1
• CAZy Family: GT2
• CAZyme Description: glycoside hydrolase family 79 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
541		58310.24	6.7793

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000081:277952-279765(-)

Full Sequence      

MFTQSAIVALLGAASSVAADVYTVPSQPNANGQPLDGFVSYSIEFASFPDFAGNKSSPNL
FSYNLINNLGLLQGHKPYIRVGGNTQDYALYNASQKASLIGIVDPSRSPDYPTTIHIGDA
YFESYGTWPGVQFSHGFNLGLGANRSEGWETLADTVPLACKALSHGNIYTWEYGNEPDLF
STSAQGPVRPSNWNESTYVWQWQNGTAEIKKQVQKHCPSLTLFGGPKFMAPSFAGTGNHL
KAPLAFQDGLDKNQDIEYFSTHNYISGATSLGVTLQGTLMNHTRTVSSVQGHLPEYNAIF
STAQAQKETPLIFGECNSLYNQGRPGLSNTFGAALWGIDFNLYAASVGFKRVHMHMGTNY
RYQAWQPIETDLASRGTKAPYYGSITVAATLGNSLLPVSISNIPLPDAREAAYAAHYSSG
LLKGHLARLTVLNLRGYNTTVDGQGLESVPNPPPRPSQTYTFAVSGARNGALVGVQRLLA
NGSDAITGITFDGWSYNYELAHGLPVRLHNVTVGETAVVKNGKVTVEVPDSSAVLLNFPL
L

Enzyme Prediction     

EC	3.2.1.31:3	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH79	36	515	2.2e-86	0.9516483516483516

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407104	Glyco_hydro_79C	2.12e-23	412	535	1	103	Glycosyl hydrolase family 79 C-terminal beta domain. This domain is found at the C-terminus of glycosyl hydrolase family 79 proteins. It's function is not yet known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ45998.1|GH79	0.0	1	541	1	541
UKZ72593.1|GH79	0.0	1	541	1	541
QYS95054.1|GH79	0.0	1	541	1	542
UKZ93451.1|GH79	0.0	1	541	1	542
UKZ70809.1|GH79	0.0	1	541	1	542

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7DFQ_A	7.55e-35	22	537	5	458	Chain A, 4-O-alpha-L-rhamnosyl-beta-D-glucuronidase [Fusarium oxysporum],7DFS_A Chain A, 4-O-alpha-L-rhamnosyl-beta-D-glucuronidase [Fusarium oxysporum]
5G0M_A	1.22e-20	49	402	37	372	beta-glucuronidase with an activity-based probe (N-acyl cyclophellitol aziridine) bound [Acidobacterium capsulatum],5G0Q_A beta-glucuronidase with an activity-based probe (N-alkyl cyclophellitol aziridine) bound [Acidobacterium capsulatum]
3VNY_A	1.32e-20	49	402	37	372	Crystal structure of beta-glucuronidase from Acidobacterium capsulatum [Acidobacterium capsulatum ATCC 51196],3VNZ_A Crystal structure of beta-glucuronidase from Acidobacterium capsulatum in complex with D-glucuronic acid [Acidobacterium capsulatum ATCC 51196],3VO0_A Crystal structure of beta-glucuronidase from Acidobacterium capsulatum covalent-bonded with 2-deoxy-2-fluoro-D-glucuronic acid [Acidobacterium capsulatum ATCC 51196]
5L77_A	3.26e-20	49	402	57	392	A glycoside hydrolase mutant with an unreacted activity based probe bound [Acidobacterium capsulatum]
5BWI_A	6.89e-11	25	538	1	445	Crystallographic structure of a bacterial heparanase [Burkholderia pseudomallei],5BWI_B Crystallographic structure of a bacterial heparanase [Burkholderia pseudomallei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7SFB0|GUS79_NEUCR	1.35e-206	23	512	27	522	Beta-glucuronidase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=NCU00937 PE=1 SV=1
sp|A2QEQ6|GUS79_ASPNC	1.79e-169	10	537	12	540	Beta-glucuronidase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=An02g11890 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000350	0.999622	CS pos: 19-20. Pr: 0.9480

TMHMM  Annotations     

There is no transmembrane helices in TRIVIDRAFT_77255-t45_1-p1.