CAZyme Information: TRIVIDRAFT_76825-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_76825-t45_1-p1
• CAZy Family: GT2
• CAZyme Description: glycoside hydrolase family 16 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
284		31196.92	4.1526

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000005:2591295-2592218(+)

Full Sequence      

MHFQSLSLLAMAISSAMATLSPNIPGMKVVWQESFVGEQGDMVDLTQWNVMTDLHNNQEL
ETYTQSSSNMQLSGGQTLQLVPQQAPTGEWTSSRIESIQSWAPAPGKTMQVQAALRGGPS
PLDTKQGMWPAFWMLGDSMRHGTPWPLCGELDIFEQINGQLTGYGTAHCDHTGGGACNEP
WGLGQSIAIPQDDEFHTWALKINRCSNNWQTETIEWYLDGNLFHTLVGAQFGDEGLWATL
AHSPMYIILNLAVGGTWPGDPNEATLSGWGNMFEVQYVAVYESA

Enzyme Prediction     

EC	3.2.1.6:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	31	281	2.8e-51	0.9956521739130435

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185691	GH16_Strep_laminarinase_like	8.30e-115	26	282	1	259	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
185693	GH16_laminarinase_like	3.83e-44	31	281	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185683	Glyco_hydrolase_16	6.96e-17	44	281	9	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
225182	BglS	1.03e-13	126	283	131	265	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
185687	GH16_beta_agarase	2.35e-09	131	281	115	257	Beta-agarase, member of glycosyl hydrolase family 16. Beta-agarase is a glycosyl hydrolase family 16 (GH16) member that hydrolyzes the internal beta-1,4-linkage of agarose, a hydrophilic polysaccharide found in the cell wall of Rhodophyceaea, marine red algae. Agarose is a linear chain of galactose units linked by alternating L-alpha-1,3- and D-beta-1,4-linkages that are additionally modified by a 3,6-anhydro-bridge. Agarose forms thermo-reversible gels that are widely used in the food industry or as a laboratory medium. While beta-agarases are also found in two other families derived from the sequence-based classification of glycosyl hydrolases (GH50, and GH86) the GH16 members are most abundant. This domain adopts a curved beta-sandwich conformation, with a tunnel-shaped active site cavity, referred to as a jellyroll fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ76742.1|GH16_3	5.19e-216	1	284	1	284
QYS95553.1|GH16_3	5.10e-200	1	283	1	283
UKZ86667.1|GH16_3	5.35e-184	1	284	2	284
UKZ67807.1|GH16_3	1.16e-180	1	284	1	283
QBB79300.1|GH16_3	3.42e-175	1	284	1	282

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7EO3_A	9.09e-38	22	283	5	280	Chain A, 1,3-beta-glucanase [Actinomycetia bacterium]
3DGT_A	3.52e-36	26	280	8	273	The 1.5 A crystal structure of endo-1,3-beta-glucanase from Streptomyces sioyaensis [Streptomyces sioyaensis]
3ATG_A	3.19e-34	29	283	5	240	endo-1,3-beta-glucanase from Cellulosimicrobium cellulans [Cellulosimicrobium cellulans]
2HYK_A	5.81e-31	29	282	9	243	The crystal structure of an endo-beta-1,3-glucanase from alkaliphilic Nocardiopsis sp.strain F96 [Nocardiopsis sp. F96]
4DFS_A	7.76e-28	23	282	14	263	Structure of the catalytic domain of an endo-1,3-beta-glucanase (laminarinase) from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],4DFS_B Structure of the catalytic domain of an endo-1,3-beta-glucanase (laminarinase) from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P23903|E13B_NIACI	2.50e-18	22	282	418	680	Glucan endo-1,3-beta-glucosidase A1 OS=Niallia circulans OX=1397 GN=glcA PE=1 SV=1
sp|Q9ZG90|KSBGL_SPHMU	4.53e-11	126	282	147	288	Keratan-sulfate endo-1,4-beta-galactosidase OS=Sphingobacterium multivorum OX=28454 PE=1 SV=1
sp|Q8N0N3|BGBP_PENMO	6.56e-07	91	272	132	319	Beta-1,3-glucan-binding protein OS=Penaeus monodon OX=6687 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000203	0.999777	CS pos: 18-19. Pr: 0.9763

TMHMM  Annotations     

There is no transmembrane helices in TRIVIDRAFT_76825-t45_1-p1.