CAZyme Information: TRIVIDRAFT_74285-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_74285-t45_1-p1
• CAZy Family: GT90
• CAZyme Description: glycosyltransferase family 31 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
503	ABDF02000005|CGC16	58110.06	6.5000

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000005:2918-4590(-)

Full Sequence      

MALFRKLSRPLLLPPTLHSRLLQNIILIASCLILLLFFLYNLREPEPTQLLPYQIYPQAN
DSIHHTVTEFLPISVQPGTDTTRELCDSFPKHVLTRIQPILKTGHGDNKEKLNAQMDSTS
ACFTPDELIIFSDLDEKIRNHHAIDILAHLPSSHYNATTFKMWEEYLAQKEMQANGILDT
EAQVKHINGWALDKFKFLPMMERAWAMKPNKDFYVFYETDTYIFWDNLFRFLQTYNPDAN
IYIGSPSPGRRDPKRGDQGTLFANGGPGYVISRGAMKTLLQRATGPYGQYTDDPLSVKFS
YLNHDDECCGDSVLGWVLWELGIPMHGHWPMFSDYGLHDIPFNDQHWCQPLITLHKTSPK
DMVDLFSWEFSQRKSQRPLLYSDVWEFHKPGTVPARENWDGGRFDAFEPPPEAVIESSKQ
CSHACGEDPGCLQWKWEGRDRGKCILLGSLQHGRARKAEKEGNDKETWVDYTSGWVEEHI
KDWRKKQQCDVVKWVGASVERKF

Enzyme Prediction     

No EC number prediction in TRIVIDRAFT_74285-t45_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367085	Fringe	2.59e-07	220	371	94	241	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ66863.1|GT31	4.34e-289	1	502	1	503
QYS96456.1|GT31	1.20e-273	1	376	1	376
UKZ49513.1|GT31	2.92e-238	207	503	1	297
UKZ87536.1|GT31	1.74e-237	1	392	1	388
QYS96455.1|GT31	2.40e-220	200	503	5	313

PDB Hits     

TRIVIDRAFT_74285-t45_1-p1 has no PDB hit.

Swiss-Prot Hits     

TRIVIDRAFT_74285-t45_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000027	0.000002

TMHMM  Annotations     

Start	End
21	40