CAZyme Information: TRIVIDRAFT_74123-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_74123-t45_1-p1
• CAZy Family: GT1
• CAZyme Description: glycoside hydrolase family 1 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
484	ABDF02000005|CGC10	55142.79	5.8991

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000005:435601-437280(-)

Full Sequence      

MSESLALPNDFEWGFATAAYQIEGAVKEGGRGPSIWDTYCHLEPSRTNGANGDVACDHYH
RYDEDFDLLTKYGAKAYRFSLSWSRIIPLGGRLDPINEEGIQFYSNLIDALLKRGVTPWV
TLYHWDLPQALHDRYGGWLNVEEVQLDFERYARLCFERFGDRVKNWITINEPWIQSIYGY
ATGSNAPGRSSINKHSTEGDTTTEPWLAGKAQIMSHARAAAVYSKEFRSSQKGQIGISLN
GDYYEPWDSSDPRDKEAAERRMEFHIGWYANPIFLKKDYPACMRKQLGDRLPALTPADFA
ILNAGETDFYGMNYYTSQFARHFEGPVPKTDFLGAIHEHQENKDGSPVGEESGIFWLRSC
PDMFRKHLGRVHSLYGKPIYITENGCPCPGEDKMTCEEAVDDPFRIRYFDSHLDSISKAI
TQDGVVVKGYFAWALLDNLEWSDGYGPRFGVTYTDYTTLKRTPKKSALVLKDMFAERQRV
KVAA

Enzyme Prediction     

EC	3.2.1.21:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	6	477	4.6e-159	0.986013986013986

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395176	Glyco_hydro_1	2.45e-167	7	473	5	447	Glycosyl hydrolase family 1.
274539	BGL	1.27e-163	8	468	1	424	beta-galactosidase.
225343	BglB	1.83e-146	5	477	2	453	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
184102	PRK13511	1.29e-110	6	481	4	469	6-phospho-beta-galactosidase; Provisional
215435	PLN02814	3.83e-106	7	467	28	473	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ76179.1|GH1	0.0	1	484	1	484
KKP05610.1|GH1	0.0	1	484	1	484
QYS96282.1|GH1	0.0	1	484	1	484
AAP57758.1|GH1|3.2.1.21	0.0	1	484	1	484
ABE22339.1|GH1|3.2.1.21	0.0	1	484	1	484

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JBO_A	0.0	1	484	2	485	Trichoderma harzianum GH1 beta-glucosidase ThBgl2 [Trichoderma harzianum]
6KHT_A	0.0	3	478	17	492	Chain A, Glycoside hydrolase family 1 [Trichoderma reesei QM6a],6KHT_B Chain B, Glycoside hydrolase family 1 [Trichoderma reesei QM6a],6KHT_C Chain C, Glycoside hydrolase family 1 [Trichoderma reesei QM6a]
6EFU_A	8.72e-183	7	476	3	461	Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],6EFU_B Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
4MDO_A	2.22e-181	4	474	23	492	Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea],4MDP_A Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea]
5JBK_A	1.16e-180	5	476	1	461	Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum],5JBK_B Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q25BW4|BGL1B_PHACH	4.63e-180	1	474	1	471	Beta-glucosidase 1B OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1B PE=1 SV=1
sp|Q25BW5|BGL1A_PHACH	3.95e-167	7	476	6	458	Beta-glucosidase 1A OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1A PE=1 SV=1
sp|Q9FIW4|BGL42_ARATH	2.26e-142	8	467	22	472	Beta-glucosidase 42 OS=Arabidopsis thaliana OX=3702 GN=BGLU42 PE=2 SV=1
sp|Q9SPP9|RG1_RAUSE	2.57e-140	8	474	23	511	Raucaffricine-O-beta-D-glucosidase OS=Rauvolfia serpentina OX=4060 GN=RG PE=1 SV=1
sp|Q339X2|BGL34_ORYSJ	1.80e-138	6	475	37	507	Beta-glucosidase 34 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU34 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000000

TMHMM  Annotations     

There is no transmembrane helices in TRIVIDRAFT_74123-t45_1-p1.