CAZyme Information: TRIVIDRAFT_73257-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_73257-t45_1-p1
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
909		95173.74	4.2203

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000001:1934865-1937656(-)

Full Sequence      

MKSTAALVGLLGLAGSALADPTWPNAIDEIEEIMTQLQSFRARKFADTVSPCSNEASGPG
RQNAAEWLRVGFHDMSTANTHFGIGGLDASLQYELDDGENTGPGHKTTLEFMAPYVSPRS
SLADLIALGVYTSVRSCGGPAVPIRVGRIDATGKGPTGVPQPQNSVFTFQQQFERMGFNV
AEMIQVTACGHTLGGVHNTEFPDIVPTGTGLNGEAGLDSTDAAFDNKVVTEYLSGETANP
LVVGPSVKIDKNSDFKVFNSDGNATMEALADADTFASTCKTVLQKMIEVVPPGVTFSDPI
VPYKVKPVGLQLTLINGGTTLQLTGFIRVKTTGLPDNSISSVSITYKNRKGTTDCGLSSC
VVTSQVQGTSHGFDDTFNFYPISTNILATSGISSFTVTVNNADGTKDIYDNNGKEYPVQD
AIVFQAPQSCVLGSSGALTAVAAVRNDRLSQGAQAKIWFKTPQTTSPVPLLQSTTVDLQK
GQCVGSYTLFNIDYTIQGGLAYQGYVDVINGDQSDSFKALTSIGGTCRAFASPAACNGGD
EGSGGTTGIPTVPSTTNAVPTTDPATSEPVTTQPPTTTVPPTTTAIPTPTHKPSVDGYVL
VSCWTEGDGVRALSGSAYANDSMTLETCRDFCSSYVYWGTEYGRECYCGNTLAKSSEAAP
IDQCNMVCGGNGAEFCGAGNRLELYSTTVTQPPSPTGTLIHEPTVGAYTLVGCWTEGQGD
RALGQAATQAADMTNEACAAFCSNYRYFGTEYGDECYCGSFLSTSSATAPLADCNMPCGG
DQFEYCGASNRLELYINPNITGGEPEQPAAAGDFVFIGCQTEGNNTRALTGAATATGTMS
NEACATFCDGFAYFGTEYGSECYCGDTLAPSSLKAPASDCNMLCSGNDLEFCGAGNRLSL
YNKKPAELT

Enzyme Prediction     

No EC number prediction in TRIVIDRAFT_73257-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	61	242	2.4e-25	0.6901960784313725

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173829	plant_peroxidase_like_1	7.22e-135	23	288	1	264	Uncharacterized family of plant peroxidase-like proteins. This is a subgroup of heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX) which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions.
396406	WSC	7.36e-24	817	894	1	80	WSC domain. This domain may be involved in carbohydrate binding.
396406	WSC	8.19e-24	603	678	3	80	WSC domain. This domain may be involved in carbohydrate binding.
396406	WSC	1.41e-23	711	788	1	80	WSC domain. This domain may be involved in carbohydrate binding.
173823	plant_peroxidase_like	2.11e-20	61	288	15	255	Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB76056.1|AA0	7.80e-308	7	907	11	934
QBZ57066.1|AA0	6.80e-278	6	795	10	799
QGA18666.1|AA5_1	5.67e-194	7	901	9	924
QRW22025.1|AA2	4.90e-111	17	530	15	538
QRV94524.1|AA2	9.89e-109	19	530	18	535

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1IYN_A	2.68e-09	68	268	29	246	Crystal structure of chloroplastic ascorbate peroxidase from tobacco plants and structural insights for its instability [Nicotiana tabacum]
5FWW_B	2.69e-08	601	689	91	182	Wnt modulator Kremen in complex with DKK1 (CRD2) and LRP6 (PE3PE4) [Homo sapiens]
7BZT_E	4.32e-08	601	689	100	191	Chain E, KRM1 [Homo sapiens],7BZU_E Chain E, KRM1 [Homo sapiens]
6SNW_E	4.37e-08	601	689	103	194	Chain E, Kremen protein 1 [Homo sapiens]
5FWS_A	4.82e-08	601	689	131	222	Wnt modulator Kremen crystal form I at 1.90A [Homo sapiens],5FWT_A Wnt modulator Kremen crystal form I at 2.10A [Homo sapiens],5FWU_A Wnt modulator Kremen crystal form II at 2.8A [Homo sapiens],5FWV_A Wnt modulator Kremen crystal form III at 3.2A [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AUF4|WSCD2_ARTBC	7.65e-184	18	795	18	715	WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07870 PE=1 SV=1
sp|P84675|PFM_CHAGB	2.87e-39	603	795	22	219	Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=CHGG_05463 PE=1 SV=2
sp|D4AUF1|WSCD1_ARTBC	2.32e-37	592	901	57	401	WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07867 PE=1 SV=1
sp|Q80XH4|WSCD1_MOUSE	2.82e-14	601	758	143	294	WSC domain-containing protein 1 OS=Mus musculus OX=10090 GN=Wscd1 PE=2 SV=1
sp|Q2TBF2|WSCD2_HUMAN	1.35e-12	697	901	117	321	WSC domain-containing protein 2 OS=Homo sapiens OX=9606 GN=WSCD2 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000337	0.999630	CS pos: 19-20. Pr: 0.9776

TMHMM  Annotations     

There is no transmembrane helices in TRIVIDRAFT_73257-t45_1-p1.