CAZyme Information: TRIVIDRAFT_72492-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_72492-t45_1-p1
• CAZy Family: GH93
• CAZyme Description: glycosyltransferase family 50 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
416	ABDF02000003|CGC6	46804.30	9.7673

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000003:1024578-1025966(+)

Full Sequence      

MSSSILSSLFRPAPLFSLAALLRLVLLLYGNWQDAHSAVKYTDIDYLVFTDAARYVSNGL
SPYSRETYRYTPLLAWMLIPTAKPHLFSFGKVVFALADLLAGWLIVRVLRKQRGMSAERA
GAFAAIWLWNPMVATISTRGSSEGLLGVLTMALLWAVEGKRVSVAGFILGLGVHFKIYPF
IYAPAIIWWMDDEHLGKGVSKLPASFAGAVIKFLSPQRIQLTLISLSTFMGLNVLMYYIY
GTPFLTHSYFHHVTRIDHRHNFSPYNIFLYLASADPSSSSLHAFLPQLLLSCLFIPFVIA
KKDLATSMMAQTFAFVTFNKVCTSQYFLWYMIFLPLYLPGSSMLRVPRLGITALLLWVLG
QAAWLQQGYQLEFLGDSTFFPGMWLASLAFFLINCWILGIVISDGAERNIQKVNMM

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	136	402	4.3e-95	0.9961832061068703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	7.56e-87	29	402	25	415	GPI mannosyltransferase
252941	Mannosyl_trans	2.32e-76	136	402	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.
399599	PIG-U	1.66e-06	51	241	39	229	GPI transamidase subunit PIG-U. Many eukaryotic proteins are anchored to the cell surface via glycosylphosphatidylinositol (GPI), which is posttranslationally attached to the carboxyl-terminus by GPI transamidase. The mammalian GPI transamidase is a complex of at least four subunits, GPI8, GAA1, PIG-S, and PIG-T. PIG-U is thought to represent a fifth subunit in this complex and may be involved in the recognition of either the GPI attachment signal or the lipid portion of GPI.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ48798.1|GT50	1.53e-302	1	416	1	416
UKZ75326.1|GT50	1.45e-284	1	416	1	397
QYS97269.1|GT50	2.25e-281	1	416	1	443
UKZ90890.1|GT50	4.02e-266	1	414	1	414
QYS97268.1|GT50	6.46e-225	1	325	1	325

PDB Hits     

TRIVIDRAFT_72492-t45_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4I073|GPI14_GIBZE	2.17e-202	11	412	9	415	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1
sp|Q5B7W0|GPI14_EMENI	9.34e-178	11	414	7	437	GPI mannosyltransferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=gpi14 PE=3 SV=1
sp|Q7S4Z3|GPI14_NEUCR	4.03e-175	2	407	15	487	GPI mannosyltransferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gim-1 PE=3 SV=1
sp|Q2TXB8|GPI14_ASPOR	2.19e-174	6	406	1	411	GPI mannosyltransferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi14 PE=3 SV=2
sp|Q4WAH2|GPI14_ASPFU	1.45e-172	12	404	8	420	GPI mannosyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi14 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.035997	0.963986	CS pos: 37-38. Pr: 0.7780

TMHMM  Annotations     

Start	End
7	29
87	109
167	189
219	241
278	300
315	337
346	365
380	402