CAZyme Information: TRIVIDRAFT_72072-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_72072-t45_1-p1
• CAZy Family: GH92
• CAZyme Description: glycoside hydrolase family 5 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
409	ABDF02000004|CGC5	46937.79	7.0089

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000004:1941364-1942593(+)

Full Sequence      

MAMLLLLIPVVFYLTVLWIREQDLNAKWRPDRESLLFSRKPLPAPLERTWISSYKLPLRT
QGRNIVDANGHRFKLSSINWYGASDELFVPGGLDIQHRSVIAETIKKMGFNSVRLPYSDE
LVMNNPVLEPRLVLANPDLEGLRAMDVFEAVTTALTDAGIAVIINNHITSATWCCGADPC
DAGWANDHLGPLCRVKQTEEEWIQHWESVMDRFVHNPLVIGADLRNEVRGLWGTMPWSKW
AAAAEKCGNRLLKMKSDWLIIVEGTESANDVSGALDRPVRLDVENRLVYSAHGYKWSGWG
SWQGRFAQRSYKSFVKTMRHNWAYLLDLDIAPVWFGELGAPNDPTVGDARYWRHLLKYLK
SIDGDFGYWALNPRKPKNSEKESYSLVHDDWITPVLDYRMKDLQELMRQ

Enzyme Prediction     

No EC number prediction in TRIVIDRAFT_72072-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	65	377	1.1e-158	0.9904761904761905

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	2.31e-27	66	373	1	270	Cellulase (glycosyl hydrolase family 5).
225344	BglC	2.86e-14	103	398	80	383	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ55077.1|GH5_24	6.90e-317	1	409	89	497
QYT00999.1|GH5_24	2.69e-307	1	409	88	496
UKZ80856.1|GH5_24	4.27e-291	1	409	89	471
UKZ59514.1|GH5_24	5.31e-291	1	409	97	505
UKZ85745.1|GH5_24	1.77e-289	1	409	97	505

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1VRX_A	2.84e-44	60	393	8	338	Chain A, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus],1VRX_B Chain B, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus]
1ECE_A	3.97e-44	60	393	8	338	Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus],1ECE_B Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus]
3VVG_A	1.17e-27	64	407	19	376	The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_B The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_C The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3W6L_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
3W6M_A	3.03e-27	64	407	19	376	Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
2ZUM_A	3.13e-27	64	407	52	409	Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_A Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_B Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_C Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P23548|GUN_PAEPO	1.67e-45	52	393	33	369	Endoglucanase OS=Paenibacillus polymyxa OX=1406 PE=3 SV=2
sp|P54583|GUN1_ACIC1	7.66e-42	60	393	49	379	Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B) OX=351607 GN=Acel_0614 PE=1 SV=1
sp|C0HLA0|GH5FP_CHAOB	2.63e-33	53	405	26	396	Glycosyl hydrolase 5 family protein OS=Chamaecyparis obtusa OX=13415 PE=1 SV=1
sp|P50400|GUND_CELFI	8.85e-27	58	393	46	400	Endoglucanase D OS=Cellulomonas fimi OX=1708 GN=cenD PE=3 SV=1
sp|P10474|GUNB_CALSA	3.72e-25	58	372	630	968	Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.881598	0.118415

TMHMM  Annotations     

There is no transmembrane helices in TRIVIDRAFT_72072-t45_1-p1.