CAZyme Information: TRIVIDRAFT_70268-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_70268-t45_1-p1
• CAZy Family: GH79
• CAZyme Description: glycosyltransferase family 2 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
650	ABDF02000074|CGC2	74135.55	8.3947

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000074:51854-53945(+)

Full Sequence      

MDSTSFFAESESGDISQTRPTRKENFTRSGPPVSLINHPATSAVGGDESSRDSSVIRNSN
SGFPPGRENTHDSQNSLNSAASFSSSILQEEAKLRWDSEEELKRVSKSLLCFQKWSLILG
LLALNGILIFLAVRFDQLYYLFIVLLSSNTMLQAFMMLAIIIATIGRHCLPCWFGRKEVI
PTEPEKLVLLLPCYNETREELTRSLDSLVEQKEIDRHPKLIFIIVDGNVRGPGMEKTTQQ
YLLEDILAQGPFRRFENGYRARDGLFMPVKVQHGYYKGLPYIFVGKSYNQGKRDSLCFAR
SFLYHFKMRSENKLTMFNKDLYEYIGTIFVQHGLDTVDYLVGMDADTVFDQFCIIEMLRE
IRSNDKLVGVCGHVCVDFDGKPFDLWSLYQSVEYSQTQGLRRMFQSRITGKVNCLPGCCQ
LIRVDESTFGDEVLRERFGYCPKPNDGMTLQILGNYSEDSIHASIIFSLFPKKQTAQALR
AKAFTIVPTSWKVFLSQRKRWALGSISNEFVMLFRPGIIIIERVQSFVAVVTWAITPFIM
AAVVELIRLLVVKGHRIFDNRVFIGLLAVLLARYAYSFCVGFWLPRNMKERAQYFAGYFI
HFASSPVMNIVIMVYSLFNSDDFKWGKTRQVIQGDEDVAEKGAARNRAAH

Enzyme Prediction     

No EC number prediction in TRIVIDRAFT_70268-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	286	638	1.5e-35	0.6584440227703985

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367353	Chitin_synth_2	8.95e-36	181	636	20	499	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).
133033	Chitin_synth_C	2.03e-23	190	508	2	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
133045	CESA_like	2.58e-15	189	425	1	164	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
224136	BcsA	1.72e-12	138	638	13	432	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
404513	Glyco_trans_2_3	0.002	343	576	5	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ51155.1|GT2	0.0	1	650	1	650
UKZ76986.1|GT2	0.0	1	650	1	650
UKZ88757.1|GT2	0.0	8	650	12	663
QYS98729.1|GT2	0.0	11	649	24	665
UKZ63886.1|GT2	0.0	11	650	15	650

PDB Hits     

TRIVIDRAFT_70268-t45_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4P9K9|CHS8_USTMA	4.97e-33	174	636	1254	1721	Chitin synthase 8 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS8 PE=3 SV=1
sp|O13395|CHS6_USTMA	5.10e-33	148	632	371	860	Chitin synthase 6 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS6 PE=3 SV=2
sp|J9VNT4|CHS5_CRYNH	1.16e-32	147	636	1211	1709	Chitin synthase 5 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS5 PE=2 SV=1
sp|J9VF17|CHS4_CRYNH	6.83e-31	148	632	470	959	Chitin synthase 4 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS4 PE=2 SV=2
sp|P30573|CHS3_CANAX	2.19e-25	190	636	667	1135	Chitin synthase 3 OS=Candida albicans OX=5476 GN=CHS3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000033	0.000005

TMHMM  Annotations     

Start	End
115	133
140	162
527	549
562	584
597	619