CAZyme Information: TRIVIDRAFT_65338-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_65338-t45_1-p1
• CAZy Family: GH72
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
541	ABDF02000091|CGC4	59671.70	5.4925

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000091:73728-75471(-)

Full Sequence      

MPLPLLAAALLGIGAVTPVRGRGDSQVRLPNYADACPDYALYASYPHRPFSSGPLALPFQ
RPSPQCRTFHSDEIERVIEEVTSRIKDPDLARLFENTFPSTTDTTVKFHTKGDKSAGFVP
VDGRRLDEGAWEGPQSFIITGDIIAEWLRDSTNQLRPYQGLAKKDPAIFDLIAGAINTQS
EYVIQSPYCNAFQPPPISELSVSANGQDDLVHPAYEPSVVFECKYELDSLAHFLALGNDF
YEATGATDFVNKRWLLAVETLLIVLKQQSEPTFNPETGQYERNTYSFQRWTNAGTETLNL
QGVGNPLNSGTGLVRSAFRPSDDATILGFFIPANAMMSVELGRAAKMLQAAGKTALATKL
SKWSEKLRAGVLEHGIVKHKKYGDVFAYEVDGYGSSILMDDANYPSLLALPVMGFCDVDD
PVYQNTRKMILDKQGNPYYLTGRGFQGIGGPHIGLKNAWPMSLLLQAQTSNDDKEIKECI
DMVLKASPRGLIHESVDVNFINQYTRSWFAWANGVFAVTILDLAKRKPHLVFGPGAAPYE
I

Enzyme Prediction     

No EC number prediction in TRIVIDRAFT_65338-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	87	521	2.8e-160	0.9975124378109452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399660	Glyco_hydro_125	0.0	87	521	1	416	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
226068	COG3538	8.65e-170	66	530	2	429	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].
225922	SGA1	5.37e-08	327	499	412	580	Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ56404.1|GH125	0.0	1	541	1	541
QYT04109.1|GH125	0.0	1	541	1	540
UKZ90116.1|GH125	0.0	1	541	1	541
UKZ64614.1|GH125	0.0	1	541	1	541
UKZ64615.1|GH125	0.0	48	541	33	526

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2P0V_A	1.65e-92	61	526	43	471	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3P2C_A	1.87e-90	61	526	21	453	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
3ON6_A	6.94e-90	61	526	23	451	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
6RQK_A	3.89e-71	74	527	12	426	Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]
3QT3_A	4.41e-71	74	527	12	426	Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Clostridium perfringens CPE0426 apo-structure [Clostridium perfringens],3QT9_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Clostridium perfringens CPE0426 complexed with alpha-1,6-linked 1-thio-alpha-mannobiose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	1.11e-185	35	531	26	504	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000237	0.999759	CS pos: 21-22. Pr: 0.9770

TMHMM  Annotations     

There is no transmembrane helices in TRIVIDRAFT_65338-t45_1-p1.