CAZyme Information: TRIVIDRAFT_60900-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_60900-t45_1-p1
• CAZy Family: GH64
• CAZyme Description: glycoside hydrolase family 16 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
771		85575.42	4.6177

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000006:354227-356746(+)

Full Sequence      

MAYVLSTSYSGESLLSSFNWFDGVDPSHGFVSYQSRQDAESMGLYHIDERTGVVRLGVDS
TNSYSVTDRGRPSIRIESKETYDHGLFIADFLHMPPSECGLWPAFWTYGDNWPFDGEIDI
IEGVNTAHTNIISAHTSDGCTQGNDINGLFSGEQLSRQCAVGTDNIGCGFNPSSEDVSSY
GDGFNAAHGGVYAMEWDPVHIRIWHFPRGLIPRDIEKKEPDPDTWGQPIAIFGGSECGVD
KYFKHMRLVLNIPLGVEKRENWTLTRIHQNFCGDYGDAVWGKTDQCNDFAPTCDEYVAKN
PEAFANAYWDVQYIDAYEFRPHIRKPRPSNPSRPGFDDSGRTTTITQTTHWTEYVTVHAT
GHASYVPHFGDVPAATTYAIEPVATKAPVNPVKIDHYSYLGCFYSNTGFQTFHEVADNKE
LTLERCVELCNNKTYVGVFDSHCFCADNLDDETRATEKEGLCNKECPGNKLEFCGGIITP
QDIDWPSGKFVSETLPLHALTVYGRVEEEKVEAPPAMAPGSNWTGVKPEKEFSKTVAEVV
EVTVFPISEEEYRGKGENDGDRHDDDKSEGDWKGGDQKDEKHDQDKDDGHDWHNHGDWHD
WFNHGADGHGADHNEGGMKDAFWIPSAGEEKGKPAEPAISEIVVPVTKTVVECPESITTK
EAIVIPTWLPPVEPKPWTPSDPVPPPPTPLLRHGDGDDHSHPPPPPPHDGGDYHPHDPPH
PPPSHDDNHNNTHPLPPPVVLVAAASTVYGGMEKYLAILGLSILVLFMRVF

Enzyme Prediction     

No EC number prediction in TRIVIDRAFT_60900-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	52	297	3.9e-73	0.9519650655021834

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185690	GH16_fungal_Lam16A_glucanase	7.51e-136	2	317	1	292	fungal 1,3(4)-beta-D-glucanases, similar to Phanerochaete chrysosporium laminarinase 16A. Group of fungal 1,3(4)-beta-D-glucanases, similar to Phanerochaete chrysosporium laminarinase 16A. Lam16A belongs to the 'nonspecific' 1,3(4)-beta-glucanase subfamily, although beta-1,6 branching and beta-1,4 bonds specifically define where Lam16A hydrolyzes its substrates, like curdlan (beta-1,3-glucan), lichenin (beta-1,3-1,4-mixed linkage glucan), and laminarin (beta-1,6-branched-1,3-glucan).
396406	WSC	8.78e-12	400	476	1	80	WSC domain. This domain may be involved in carbohydrate binding.
185693	GH16_laminarinase_like	9.63e-12	96	204	89	175	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
214616	WSC	2.66e-07	397	476	2	85	present in yeast cell wall integrity and stress response component proteins. Domain present in WSC proteins, polycystin and fungal exoglucanase
185691	GH16_Strep_laminarinase_like	2.36e-06	73	148	70	165	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ47266.1|GH16_1	0.0	1	771	1	771
UKZ73836.1|GH16_1	0.0	1	562	1	545
QYS93645.1|GH16_1	0.0	1	770	1	766
UKZ60234.1|GH16_1	2.93e-272	1	682	1	644
UKZ85129.1|GH16_1	7.50e-271	1	770	1	738

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JVV_A	4.52e-79	2	317	2	297	Crystal structure and characterization an elongating GH family 16 beta-1,3-glucosyltransferase [Paecilomyces sp. 'thermophila'],5JVV_B Crystal structure and characterization an elongating GH family 16 beta-1,3-glucosyltransferase [Paecilomyces sp. 'thermophila']
3WDU_A	1.44e-73	11	317	11	295	The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila'],3WDU_B The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila'],3WDU_C The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila'],3WDU_D The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila']
3WDT_A	1.49e-73	11	317	12	296	The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDT_B The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDT_C The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDT_D The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDV_A The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDV_B The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDV_C The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDV_D The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila']
3WDY_A	1.03e-72	11	317	10	294	The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDY_B The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDY_C The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDY_D The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila']
3WDW_A	1.10e-72	11	317	12	296	The apo-form structure of E113A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDW_B The apo-form structure of E113A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDX_A The complex structure of E113A with glucotriose [Paecilomyces sp. 'thermophila'],3WDX_B The complex structure of E113A with glucotriose [Paecilomyces sp. 'thermophila']

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AJR9|EGLX_ARTBC	3.68e-75	3	333	20	325	Endo-1,3(4)-beta-glucanase ARB_04519 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_04519 PE=3 SV=1
sp|Q5BAP5|EGLX_EMENI	5.75e-70	3	318	29	324	Endo-1,3(4)-beta-glucanase xgeA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xgeA PE=3 SV=1
sp|Q2UIE6|EGLX_ASPOR	8.45e-67	3	318	31	326	Probable endo-1,3(4)-beta-glucanase AO090023000083 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090023000083 PE=3 SV=1
sp|B8N7S7|EGLX_ASPFN	1.61e-66	3	318	31	326	Probable endo-1,3(4)-beta-glucanase AFLA_105200 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=AFLA_105200 PE=3 SV=1
sp|Q9USW3|YHZ7_SCHPO	2.78e-65	3	319	129	419	Probable glycosidase C21B10.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC21B10.07 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000005

TMHMM  Annotations     

There is no transmembrane helices in TRIVIDRAFT_60900-t45_1-p1.