CAZyme Information: TRIVIDRAFT_59776-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_59776-t45_1-p1
• CAZy Family: GT64
• CAZyme Description: carbohydrate-binding module family 48 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
506		53772.24	4.0817

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000002:2010349-2013214(+)

Full Sequence      

MGSYTFKWEHPAEEVFVTGTFDNWTKSEQLAKEGDVFQKTVALKDASQKIYFKYVVDGNW
TVNESAPKEADHEGNVNNFITPEDILKSDPAAAFISTVTPQSTTAKMASEQPVEKSEGIA
TPSDVPGGFPATPNTELDKTVTINPLPAAAGAINPIQLAPGEKVPDVGIESTNEHVKLDQ
ESYEKSDALPGVVAADLPPITSNLIPESSLPVTAATEDVHINTVGTDATTVGLAAQVPLE
AKVPEVVKESQEKANVEPEAAAVPEEVEAKAKVEEELKEKVTEAPVTSEDKSAVETGAIA
TDAATTDIVQPEPVEETAAKEETPEVSPEVPAEVKESIVEAGKSPEAAANTAAVEEKKEV
EAELLKEVKPVEAVDEPKAEETKAPVEVPVTSATITDAVEESKTTEEPKVEEPQTEVAKT
EAPAPEVAPIDTTVASEAPKADAVDTPVTETDKTEVPPVDAPTEEPAKADAANGTNGTHD
DKASEKKKNRFSSFFSRFRHRFSDKN

Enzyme Prediction     

No EC number prediction in TRIVIDRAFT_59776-t45_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
199889	E_set_AMPKbeta_like_N	8.31e-25	3	81	1	79	N-terminal Early set domain, a glycogen binding domain, associated with the catalytic domain of AMP-activated protein kinase beta subunit. E or "early" set domains are associated with the catalytic domain of AMP-activated protein kinase beta subunit glycogen binding domain at the N-terminal end. AMPK is a metabolic stress sensing protein that senses AMP/ATP and has recently been found to act as a glycogen sensor as well. The protein functions as an alpha-beta-gamma heterotrimer. This N-terminal domain is the glycogen binding domain of the beta subunit. This domain is also a member of the CBM48 (Carbohydrate Binding Module 48) family whose members include pullulanase, maltooligosyl trehalose synthase, starch branching enzyme, glycogen branching enzyme, glycogen debranching enzyme, and isoamylase.
406865	AMPK1_CBM	3.96e-23	5	89	4	83	Glycogen recognition site of AMP-activated protein kinase. AMPK1_CBM is a family found in close association with AMPKBI pfam04739. The surface of AMPK1_CBM reveals a carbohydrate-binding pocket.
236766	rne	6.73e-10	244	429	850	1030	ribonuclease E; Reviewed
236766	rne	3.21e-09	285	472	846	1030	ribonuclease E; Reviewed
236766	rne	6.28e-07	250	473	684	967	ribonuclease E; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ46716.1|CBM48	1.20e-266	1	506	1	553
UKZ73298.1|CBM48	9.58e-263	1	506	1	521
QYS94262.1|CBM48	1.53e-216	1	506	1	581
UKZ62401.1|CBM48	1.09e-166	1	504	1	605
QGI81967.1|CBM48	1.22e-110	1	406	1	513

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2F15_A	3.48e-07	7	89	15	92	Glycogen-Binding Domain Of The Amp-Activated Protein Kinase beta2 Subunit [Homo sapiens]
4Y0G_A	4.11e-07	7	80	16	87	beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) [Rattus norvegicus],4Y0G_B beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) [Rattus norvegicus],4YEE_A beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus],4YEE_B beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus],4YEE_C beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus],4YEE_D beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus],4YEE_E beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus],4YEE_F beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus],4YEE_G beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus],4YEE_H beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus],4YEE_I beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus],4YEE_J beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus],4YEE_K beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus],4YEE_L beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus],4YEE_M beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus],4YEE_N beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus],4YEE_O beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus],4YEE_P beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus],4YEE_Q beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus],4YEE_R beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus]
2LU3_A	4.32e-07	7	89	23	100	Solution NMR structure of the apo-form of the beta2 carbohydrate module of AMP-activated protein kinase [Rattus norvegicus],2LU4_A Solution NMR structure of the beta2 carbohydrate module of AMP-activated protein kinase bound to glucosyl-cyclodextrin [Rattus norvegicus]
4REW_B	2.31e-06	7	89	7	84	Crystal structure of the non-phosphorylated human alpha1 beta2 gamma1 holo-AMPK complex [Homo sapiens]
7JHG_B	2.34e-06	7	89	8	85	Chain B, 5'-AMP-activated protein kinase subunit beta-2 [Homo sapiens],7JHH_B Chain B, 5'-AMP-activated protein kinase subunit beta-2 [Homo sapiens],7JIJ_B Chain B, 5'-AMP-activated protein kinase subunit beta-2 [Homo sapiens],7M74_B Chain B, 5'-AMP-activated protein kinase subunit beta-2 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A6ZRR2|MDG1_YEAS7	9.63e-12	4	117	8	121	Signal transduction protein MDG1 OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=MDG1 PE=3 SV=1
sp|B3LP25|MDG1_YEAS1	2.29e-11	4	117	8	121	Signal transduction protein MDG1 OS=Saccharomyces cerevisiae (strain RM11-1a) OX=285006 GN=MDG1 PE=3 SV=1
sp|C8ZG55|MDG1_YEAS8	4.07e-11	4	117	8	121	Signal transduction protein MDG1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) OX=643680 GN=MDG1 PE=3 SV=1
sp|C7GTE8|MDG1_YEAS2	4.07e-11	4	117	8	121	Signal transduction protein MDG1 OS=Saccharomyces cerevisiae (strain JAY291) OX=574961 GN=MDG1 PE=3 SV=1
sp|P53885|MDG1_YEAST	4.07e-11	4	117	8	121	Signal transduction protein MDG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MDG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000060	0.000000

TMHMM  Annotations     

There is no transmembrane helices in TRIVIDRAFT_59776-t45_1-p1.