CAZyme Information: TRIVIDRAFT_59074-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_59074-t45_1-p1
• CAZy Family: GH55
• CAZyme Description: glycoside hydrolase family 5 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
465	ABDF02000078|CGC4	52047.01	5.1316

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000078:497998-499573(+)

Full Sequence      

MMSTISVALTLLGQSSAWSYNTNSQYKANIKVNARQTYQTMIGGGCSGAFGIACQQFGSS
GLSPENQQRVTQILFDENIGGLSIVRNDIGSSPGTTILPTCPATPDGKFNYVWDGSDNCQ
FNLTKTALKYNPELYVYADAWSAPGCMKTVGTENLGGQICGVRGTNCKYDWRQAYADYLV
QYVRFYKEEGIDVSLLGAWNEPDFNPFTYESMLSDGYQAKDFLEVLYPTLKKAFPKVDVS
CCDATGARQERNILYELQQAGGEKFFDIATWHNYQSNPERPFNAGGKPNIQTEWADGTGP
WNSTWDYSGQLAEGLQWALYMHNAFVNSDTSGYTHWWCAQNTNGDNALIRLDHDNYEVSS
RLWAFAQYFRFARPGSVRVDATSDVENVYVTAYVNKNGTVAIPVINAAHFPYDVTIDLEG
IKKRKLSEYLTDNSHNVTLQSRYKISGNSLKVTVEPRAMKTFWLE

Enzyme Prediction     

EC	3.2.1.-:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	27	463	1.6e-167	0.9954853273137697

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227807	XynC	2.66e-29	29	462	35	426	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].
307945	Glyco_hydro_30	1.17e-09	123	239	83	199	Glycosyl hydrolase family 30 TIM-barrel domain.
407314	Glyco_hydro_30C	2.45e-05	375	462	1	63	Glycosyl hydrolase family 30 beta sandwich domain.
396577	Glyco_hydro_59	4.58e-05	64	210	20	151	Glycosyl hydrolase family 59.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ57081.1|GH30_7	0.0	1	465	1	465
UKZ82812.1|GH30_7	0.0	1	465	1	465
QYT04915.1|GH30_7	0.0	1	465	1	465
AAV25955.1|GH30_7|3.2.1.-	0.0	1	465	1	465
AAP64786.1|GH30_7|3.2.1.-	0.0	1	465	1	465

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IUJ_A	2.71e-91	28	465	22	472	Chain A, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612],6IUJ_B Chain B, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612]
6KRL_A	2.66e-90	25	465	92	543	Crystal structure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris [Saccharomyces uvarum],6KRN_A Crystal structure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris in complex with aldotriuronic acid [Saccharomyces uvarum]
6M5Z_A	5.47e-78	18	462	2	451	Chain A, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612],6M5Z_B Chain B, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612]
7O0E_A	1.98e-77	30	407	5	387	Chain A, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464],7O0E_G Chain G, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
7NCX_AAA	2.40e-76	25	407	7	394	Chain AAA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2Q1N4|XY30A_MYCTT	1.82e-77	25	407	24	411	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1
sp|Q45070|XYNC_BACSU	6.08e-14	120	462	97	418	Glucuronoxylanase XynC OS=Bacillus subtilis (strain 168) OX=224308 GN=xynC PE=1 SV=1
sp|Q6YK37|XYNC_BACIU	6.10e-13	120	462	98	419	Glucuronoxylanase XynC OS=Bacillus subtilis OX=1423 GN=xynC PE=3 SV=2
sp|O16580|GLCM1_CAEEL	6.89e-09	108	406	154	481	Putative glucosylceramidase 1 OS=Caenorhabditis elegans OX=6239 GN=gba-1 PE=1 SV=2
sp|Q9UB00|GLCM4_CAEEL	2.79e-08	16	416	74	494	Putative glucosylceramidase 4 OS=Caenorhabditis elegans OX=6239 GN=gba-4 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000508	0.999499	CS pos: 17-18. Pr: 0.9772

TMHMM  Annotations     

There is no transmembrane helices in TRIVIDRAFT_59074-t45_1-p1.