CAZyme Information: TRIVIDRAFT_59043-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_59043-t45_1-p1
• CAZy Family: GH55
• CAZyme Description: glycoside hydrolase family 75 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
234		24479.49	3.5394

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000078:364031-364868(-)

Full Sequence      

MNSKTLFTLATLGAVASAFNLPDNLRQIYENHISGDCQNPLSDAFEGGAQYCGDIPNAIF
LKGSDGNYDNMDVDCDGANNSGGACANDPTGQGQTSFQDTVQSFGIEDLDANIHPYVVFG
NEGDSPSFAPQDFGMEPLSVVAVVCNNQVIYGVWGDTNGFTSTGESSISLAQLCFPDDGL
TGDNGHDQKDVLYIGFTGSDAVPGTSANWSAGSAEEFEDSIKDLGDRLVAGLLA

Enzyme Prediction     

EC	3.2.1.132:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH75	8	230	4.7e-80	0.9772727272727273

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399960	Glyco_hydro_75	3.73e-99	71	230	1	164	Fungal chitosanase of glycosyl hydrolase group 75. This family consists of several fungal chitosanase proteins. Chitin, xylan, 6-O-sulphated chitosan and O-carboxymethyl chitin are indigestible by chitosanase. EC:3.2.1.132. The mechanism is likely to be inverting, and the probable catalytic neutrophile base is Asp, with the probable catalytic proton donor being Glu. (see the Chitosanase web-page from CAZY).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ57039.1|GH75	4.36e-174	1	234	1	234
UKZ82772.1|GH75	3.44e-171	1	234	1	234
QYT04861.1|GH75	4.46e-158	1	234	1	234
UKZ72288.1|GH75	1.73e-137	1	234	1	235
UKZ94694.1|GH75	4.07e-136	1	234	1	235

PDB Hits     

TRIVIDRAFT_59043-t45_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WB37|CSN_ASPFU	2.22e-107	6	234	4	242	Endo-chitosanase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=csn PE=3 SV=1
sp|Q2U1H5|CSNB_ASPOR	5.22e-101	16	234	15	241	Endo-chitosanase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csnB PE=3 SV=1
sp|Q875I9|CSN_ASPFM	1.35e-100	1	234	1	238	Endo-chitosanase OS=Neosartorya fumigata OX=746128 GN=csn PE=1 SV=1
sp|Q2U3M5|CSN_ASPOR	3.26e-98	12	234	11	245	Endo-chitosanase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csn PE=3 SV=1
sp|Q9P961|CSN_ASPOZ	3.26e-98	12	234	11	245	Endo-chitosanase OS=Aspergillus oryzae OX=5062 GN=csn PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000226	0.999748	CS pos: 18-19. Pr: 0.9728

TMHMM  Annotations     

There is no transmembrane helices in TRIVIDRAFT_59043-t45_1-p1.