CAZyme Information: TRIVIDRAFT_58449-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_58449-t45_1-p1
• CAZy Family: GH54|CBM42
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
593		62410.01	5.8143

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000086:376504-378352(-)

Full Sequence      

MASYDYIIVGGGLAGLVLAARLTEDSSKRVLVLEAGEDLTADARTSVPAMWPTLLNTDAD
WKFRTAAQAGFNNREISFPQGKLLGGSSALNGLSFTPSSKANVDAWAKLGNPGWDWASFS
KSLAKSYTLTSKAGTTGSGPLQLSYPNDTNNSWPKIWQQTLGSLGFRQSGESYTQQSSGP
VTVADSIHPATKTRSYAGNAYLEPARSRENLTVVTGAAVSKIVFAKDGSAVTAEGVQYVK
DGETQTATGKEIILTAGTINSPRILEHSGVGDSKLLAKLGVDVVIDNPNVGENLQNHPMA
GLSFEALEDAETIDGLSRQDPAALQAAMAAYAQQLGPFASSGTNNAAQLPFPGIQTAEGK
AEVEALIEKYITGAKNVTSPFDKAQAEFVRSILTSPEEASGYYISFSGFASFNPDGSMAP
PPPGTEKYFSVALLLTHPLSRGSVHINSASETSTDVTIDPQYFSHPLDIEIFARHLRFVE
SLASAEPLASHLKVGGKRNPAAPPAGIFSAASGLEKAKEYLRQTAVGAHHFTGTCSMMPK
DLGGVVDAELRVYGCPNLRVADASIIPLTPRANPQATVYGVAEHAATIIKGGL

Enzyme Prediction     

No EC number prediction in TRIVIDRAFT_58449-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	3	590	1.5e-161	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	6.85e-86	1	591	5	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	9.10e-83	1	591	3	533	choline dehydrogenase; Validated
398739	GMC_oxred_C	4.29e-36	438	585	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	4.40e-29	3	578	55	565	Protein HOTHEAD
366272	GMC_oxred_N	2.46e-22	72	298	15	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ52598.1|AA3_2	0.0	1	593	1	593
QYS99722.1|AA3_2	0.0	1	593	1	595
UKZ90567.1|AA3_2	0.0	1	593	1	596
AEO71939.1|AA3_2	3.80e-167	3	593	7	604
ANH22750.1|AA3_2	2.99e-163	5	590	45	642

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	6.72e-60	4	590	2	562	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	6.85e-60	2	590	1	563	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4YNT_A	1.05e-59	3	590	5	565	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6O9N_A	2.87e-58	4	589	36	638	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
6ZE2_A	4.06e-56	2	590	4	583	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5GMY3|GMCH_MALSM	4.06e-84	3	591	46	617	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	4.06e-84	3	591	46	617	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|A0A161CEV4|CITC_MONRU	1.55e-78	4	590	14	609	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	1.55e-78	4	590	14	609	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	3.26e-75	3	593	39	633	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998188	0.001831

TMHMM  Annotations     

There is no transmembrane helices in TRIVIDRAFT_58449-t45_1-p1.