CAZyme Information: TRIVIDRAFT_53596-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_53596-t45_1-p1
• CAZy Family: GH37
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
642		69625.42	4.3728

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000046:15471-17462(+)

Full Sequence      

MPGSPFTTPAFLDNGEFFMDQGNVIQMNWPNVSDAFSTPVAIASASFPGWDWTRPWPGGD
IVNGHSVHLTVAPEVLTDPTVVVDATTVLSSLTFGIPDSMISGGKALPMDPSWYICRHVF
ITTKPEAKKSADEGDGCGFLEQACLDDLASILSNDWGKTDNNTMCAQLAFDPLPESCGSS
FGYARQDSWYADNTVIANSVLGPLETIPKQQQYSWRIGTGYHSPYDPIPYEIAANRTYLV
ATAWGYSKKLAASARKTPKVTWTCISSGDAYVPPLPPPPPPSSTTTTTPSKPTSTPTVIP
NTDAYYDDFTAGLKQWTTYGDSFSSDSRLLIADYSLGDKALLKSSYSNFTFEADITLPSD
SGNAGLIFRVSNPSDGADAYKGYYAGISTENNVVLGRAANDWTQISLVDVDIAANKAHHL
KVKVRENKIDVYVNDMTKSLISATDSTYTSGMDGVRVFDTGAAFDNVQIFPLAFKDDFTS
GSMAKWISYGGDYATKNAALVGQASSGGKALIRDTLYSDFVYEADVTIWDESGDAGLVFR
ASSPYDGTDGYYGYYAGFGNGYIVLGRSDDGWNELANVNASIQHGTAHHIMVRARQNVLS
IFVDDMNKPKIEMGDDTYLTGLNGVRVYETKTTFDNVVIYTM

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM66	313	467	2.3e-37	0.9806451612903225
CBM66	484	637	7.5e-32	0.9741935483870968

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399445	DUF1080	8.64e-11	313	469	11	181	Domain of Unknown Function (DUF1080). This family has structural similarity to an endo-1,3-1,4-beta glucanase belonging to glycoside hydrolase family 16. However, the structure surrounding the active site differs from that of the endo-1,3-1,4-beta glucanase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ76854.1|CBM66	0.0	1	642	1	642
UKZ60433.1|CBM66	0.0	1	642	1	642
UKZ50510.1|CBM66	0.0	1	642	1	607
UKZ56147.1|CBM66	1.20e-278	7	642	6	642
UKZ81890.1|CBM66	2.89e-268	7	642	6	636

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4B1L_A	1.08e-10	309	467	6	161	Carbohydrate Binding Module Cbm66 From Bacillus Subtilis [Bacillus subtilis]
4AZZ_A	1.25e-10	309	467	5	160	Carbohydrate binding module CBM66 from Bacillus subtilis [Bacillus subtilis],4AZZ_B Carbohydrate binding module CBM66 from Bacillus subtilis [Bacillus subtilis]
4B1M_A	1.61e-10	309	467	26	181	Carbohydrate Binding Module Cbm66 From Bacillus Subtilis [Bacillus subtilis],4B1M_B Carbohydrate Binding Module Cbm66 From Bacillus Subtilis [Bacillus subtilis],4B1M_C Carbohydrate Binding Module Cbm66 From Bacillus Subtilis [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P05656|SACC_BACSU	1.10e-08	309	467	518	673	Levanase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacC PE=1 SV=1
sp|O31411|SACC_BACL7	9.10e-06	352	473	266	390	Levanase (Fragment) OS=Bacillus sp. (strain L7) OX=62626 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000017

TMHMM  Annotations     

There is no transmembrane helices in TRIVIDRAFT_53596-t45_1-p1.