CAZyme Information: TRIVIDRAFT_53154-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_53154-t45_1-p1
• CAZy Family: GH31
• CAZyme Description: glycosyltransferase family 1 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
922	ABDF02000060|CGC2	100952.98	9.8454

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000060:51126-53894(-)

Full Sequence      

MASRTQRSRQKSVVLGEFGKCTGRAQPDGRMSITVHDTAHTGYIANAVGAVKYSMQSRRK
MTAADARENAPKLAQIPQKLNIVIMVVGSRGDVQPFLRIGKQLKEDYHHRVRIATHPIFR
DIVESQAGLEFFSVGGDPSELMEFMVKNPGLIPTFRTVKAGEIGKRRAAMATMLDGFWRA
CIHATEDDCTSLQANASAPNAFADKDIFIADAIISNPPSFAHIHCAEALGIPLHLVFTFP
YTPTRAFPHPLANIKGNTENAKDGGYANFMSYPLIETMTWQGLGDLINDFRVRTLALDAV
STFWAPYAIYRMHVPFTYLWSPALIPKPNDWGEEINISGFVFLDLASAFDPPQPLVDFLN
AGEPPIYIGFGSIVVDNPKSFTKIIFDAVGKAGVRALVSRGWGGLGLDKDQVPDNIFMLD
NTPHDWLFPKIKACVHHGGAGTTAIGLKCGLPTMIIPFFGDQYFWGSMVGKSGAGPKPIP
YKRLNYENFAEGIGYLLTEEAKSAAEEIAESIRADGDGAKNTMESFQRQLKMYGPPTLSC
SIIKSDVAVWKVKGTHIRLSTLAAAMLVDGGHLSWNKLRLLRHSEWSDFGGPGEPITAIA
ESLKNSVRDVFQGIASAPYRLGRTTKQRLRQRSRKKSKEGNATKPLPNASNEMSGSAATS
CTGNPRTRRQSLIPVSHVQYGRDISSSLIETGSALAKAPTLFIVALAQGCHNAPRLYGDD
TVRRLHRVTGFHSGLVASRREFVYSIFDGVTGVVTLPIRGTRNEGAVGLLKGMGMGLGGL
VLKPLSAIVGPVGYTMQGIMKQIQRRNSPQKFVRLARIAEGQRGVSELHGTEAEMVRRQI
VAGWEVLQELHQAVADTDRWAYLTGKASKVEFLFINVDRAKVYLDALKSGKSVDDVMAMY
EAWNIKPQDPAMKKTNSSGTRC

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	218	516	7e-47	0.6989528795811518

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	5.28e-73	80	528	1	403	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	1.78e-38	82	525	4	394	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	2.97e-17	82	248	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
273616	MGT	1.08e-06	362	475	224	336	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
278624	UDPGT	3.74e-04	350	462	259	372	UDP-glucoronosyl and UDP-glucosyl transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ54341.1|GT1	0.0	1	922	156	1077
UKZ80113.1|GT1	0.0	1	922	124	1025
QLI64812.1|GT1	0.0	21	921	160	1053
QLI74049.1|GT1	0.0	10	910	173	1069
QPH15785.1|GT1	0.0	2	911	137	1033

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	2.05e-81	84	539	24	448	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	3.54e-81	84	539	44	468	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	4.84e-27	80	516	1	386	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	2.76e-24	80	529	1	384	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1RRV_A	8.76e-21	352	519	226	390	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9XIG1|U80B1_ARATH	1.45e-127	79	538	155	578	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q9M8Z7|U80A2_ARATH	6.29e-125	64	530	178	610	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|Q6C8M8|ATG26_YARLI	1.06e-77	71	530	986	1413	Sterol 3-beta-glucosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ATG26 PE=3 SV=3
sp|A7A179|ATG26_YEAS7	5.67e-76	84	539	744	1168	Sterol 3-beta-glucosyltransferase OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=ATG26 PE=3 SV=1
sp|Q06321|ATG26_YEAST	1.92e-75	84	539	744	1168	Sterol 3-beta-glucosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATG26 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000043	0.000005

TMHMM  Annotations     

There is no transmembrane helices in TRIVIDRAFT_53154-t45_1-p1.