CAZyme Information: TRIVIDRAFT_52707-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_52707-t45_1-p1
• CAZy Family: GH30
• CAZyme Description: polysaccharide lyase family 7 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
246	ABDF02000069|CGC1	25596.32	5.8238

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000069:108315-109055(-)

Full Sequence      

MPALKTLLASTLAAAALNPSCAPGGNFDLSKWSLQLPVGNPGSPTTIPASQLEGCGGYQD
PGHHYFFTESGDGALVMKVPGAPSNTGCVTTPNSQHCRTELRESNPSSWSPNNANNKLTV
TLAVEQPDNSGHGTVIGQIHIDDSVSTKPVAELYYSSSGVLAMGVEQTRSGGNEIITTVG
NVPVGQQFTYTISYSSNVLSVSINGGAAKTLSTYSLDAPPSYFKVGNYNQGTSASDVHFF
AINVSH

Enzyme Prediction     

No EC number prediction in TRIVIDRAFT_52707-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL7	27	246	7e-88	0.9953271028037384

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400923	Alginate_lyase2	2.81e-56	27	246	1	222	Alginate lyase. Alginate lyases are enzymes that degrade the linear polysaccharide alignate. They cleave the glycosidic linkage of alignate through a beta-elimination reaction. This family forms an all beta fold and is different to all alpha fold of pfam05426.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ80219.1|PL7_4	6.18e-180	1	246	1	246
UKZ54441.1|PL7_4	6.18e-180	1	246	1	246
QYT01729.1|PL7_4	1.38e-172	1	246	1	248
OTA01262.1|PL7_4	7.36e-168	1	246	1	248
UKZ86442.1|PL7_4	3.33e-162	1	246	1	249

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7NDE_A	1.80e-71	17	246	3	231	Chain A, Glucuronan lyase [Trichoderma parareesei]
2CWS_A	4.04e-16	19	246	2	227	Crystal structure at 1.0 A of alginate lyase A1-II', a member of polysaccharide lyase family-7 [Sphingomonas sp. A1],2Z42_A Crystal Structure of Family 7 Alginate Lyase A1-II' from Sphingomonas sp. A1 [Sphingomonas sp.]
2ZA9_A	7.61e-16	19	246	1	226	Chain A, Alginate lyase [unidentified]
2ZAB_A	1.45e-15	19	246	1	226	Chain A, Alginate lyase [Sphingomonas sp. A1],2ZAC_A Chain A, Alginate lyase [Sphingomonas sp. A1]
2ZAA_A	1.39e-14	19	246	1	226	Chain A, Alginate lyase [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59478|ALYA_KLEPN	8.29e-08	22	230	24	282	Alginate lyase OS=Klebsiella pneumoniae OX=573 GN=alyA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.017521	0.982457	CS pos: 22-23. Pr: 0.6884

TMHMM  Annotations     

There is no transmembrane helices in TRIVIDRAFT_52707-t45_1-p1.