CAZyme Information: TRIVIDRAFT_52690-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_52690-t45_1-p1
• CAZy Family: GH30
• CAZyme Description: glycoside hydrolase family 5 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
481		56354.53	6.2621

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000071:190701-192146(-)

Full Sequence      

MTVGGFLHTKGTKILRPDGTPIVLRGAATGGHLNMENFITGFPGHEEEHKEAMLKTMGKE
KYDFFWSKFYEYFWTDKDAELFASMKFNCLRIPFNYRHFLDDSDLTKIKPEGFALIDRIV
ESCANHGIYTILDLHAVPGGQNQDWHSDSAIHKAQFWDFTYFQDRMIDLWQAIASHYKNN
TWVAGYNPLNEPADPSHVRLIQFYDRVDKAIREVDPNHILFLDGNTYAADFRQFPKTPYA
NTVYSIHDYSNYGFPKTPEKYTGTKVQREKLKQQYERKIEYMKELNVPVWNGEWGPVYAS
KMRGDDAVEETNASRYHVLKDQLAVYAEGDPSGDKSPISWSIWLYKDIGYQGLTHISPES
KWYTHLRSWLDKKLELGLDRWGRDENIAVEKSIYKPIKDHFRAVIPEHLQRSVYPKTWDV
GDYIDRVLRDMLLSQYLTHEFAEYFKDLSFEELDELAGSFKLENMVVRNELVEILRNSHK
D

Enzyme Prediction     

EC	3.2.1.4:2	3.2.1.37:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	50	348	1.5e-125	0.9965034965034965

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	2.06e-32	65	309	18	251	Cellulase (glycosyl hydrolase family 5).
225344	BglC	5.19e-16	66	350	66	370	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ53402.1|GH5_22	0.0	1	481	1	481
UKZ79189.1|GH5_22	0.0	1	481	1	481
QYT02907.1|GH5_22	0.0	1	481	1	481
ANB14150.1|GH5_22	1.11e-251	5	475	6	475
ANB12240.1|GH5_22	2.56e-248	1	475	1	476

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CEC_A	8.42e-21	61	351	16	321	Chain A, ENDOGLUCANASE CELC [Acetivibrio thermocellus]
1CEN_A	2.09e-20	61	351	16	321	Chain A, CELLULASE CELC [Acetivibrio thermocellus],1CEO_A Chain A, CELLULASE CELC [Acetivibrio thermocellus]
1ECE_A	1.22e-09	4	300	3	289	Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus],1ECE_B Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus]
1VRX_A	6.81e-09	4	300	3	289	Chain A, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus],1VRX_B Chain B, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus]
5WH8_A	1.36e-08	5	250	12	212	Cellulase Cel5C_n [uncultured organism]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|W8QRE4|XYL5_PHACH	2.67e-170	6	478	3	468	Beta-xylosidase OS=Phanerodontia chrysosporium OX=2822231 GN=Xyl5 PE=1 SV=2
sp|A3DJ77|GUNC_ACET2	2.36e-20	61	351	16	321	Endoglucanase C OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celC PE=3 SV=1
sp|P23340|GUNC_CLOSF	2.36e-20	61	351	16	321	Endoglucanase C307 OS=Clostridium sp. (strain F1) OX=1508 GN=celC307 PE=1 SV=1
sp|P0C2S3|GUNC_ACETH	4.33e-20	61	351	16	321	Endoglucanase C OS=Acetivibrio thermocellus OX=1515 GN=celC PE=1 SV=1
sp|A1D4Q5|EXGA_NEOFI	2.51e-09	23	234	41	258	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000082	0.000000

TMHMM  Annotations     

There is no transmembrane helices in TRIVIDRAFT_52690-t45_1-p1.