CAZyme Information: TRIVIDRAFT_49826-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_49826-t45_1-p1
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
538		60932.06	7.7915

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000078:159290-160906(-)

Full Sequence      

MNRAIDALKRENLNVLKPGEPDYERSVITTNRLYRFSRPNCVIHPKSILDVQKVVNEAVS
QNIAITVKNGGHSYAGFSTASQGILLDLKELNKGKIDIESKIVTLEGGMVWGQVYMLLIN
GKHDGYIINGGRCPSVGASGFMLGGGLGPFTRSFGMGSDTLKEATIVTANGKRVTVKDTD
DPSSPKGELFWALRGAGGANFGVLVKMKLALQELSNKNGTVVAGRYTWYPKSKKFDNDVV
DIMNGIYTTNWPDRMTMDTTWLCDLREAPNEVGVRLIFYYDGDKDGFDQLIDQYIPGELA
TQIKRRALPEKSTRFLHESLDAQWAEDIRSFPSTNLYDIYTSFVLKNDMNTIKNVTSILQ
NWTAKFKERFAGEKVSFQITWIHSGGRAGDRNAPNTAFYWRDAVYHTYIMIEWVDKWMER
DMRGFLQEVKQQLRPHSIDGKAAFINFPDSAMCKSAHEQAYYGDNTEKLQRVKKYWDPDN
FFNWAQGIHLPESKARKPTVAPDEESLTDSIAGQQWEFFKPANFLAELKQSADFQFDR

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	33	488	3.5e-65	0.980349344978166

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	1.26e-28	39	176	1	138	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	4.56e-28	30	483	23	451	FAD/FMN-containing dehydrogenase [Energy production and conversion].
369658	BBE	1.54e-12	443	488	1	44	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.
273751	FAD_lactone_ox	5.02e-06	45	209	21	176	sugar 1,4-lactone oxidases. This model represents a family of at least two different sugar 1,4 lactone oxidases, both involved in synthesizing ascorbic acid or a derivative. These include L-gulonolactone oxidase (EC 1.1.3.8) from rat and D-arabinono-1,4-lactone oxidase (EC 1.1.3.37) from Saccharomyces cerevisiae. Members are proposed to have the cofactor FAD covalently bound at a site specified by Prosite motif PS00862; OX2_COVAL_FAD; 1.
215242	PLN02441	0.001	35	110	61	138	cytokinin dehydrogenase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW27390.1|AA7	1.90e-31	15	490	43	492
AEO63154.1|AA7	2.98e-30	6	488	30	489
QRW00715.1|AA7	7.47e-30	14	490	41	491
QRW15212.1|AA7	1.38e-29	14	490	41	491
QRV86657.1|AA7	1.38e-29	14	490	41	491

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Y08_A	1.15e-28	11	491	32	528	Structure of the substrate-free FAD-dependent tirandamycin oxidase TamL [Streptomyces sp. 307-9],2Y08_B Structure of the substrate-free FAD-dependent tirandamycin oxidase TamL [Streptomyces sp. 307-9],2Y3R_A Structure of the tirandamycin-bound FAD-dependent tirandamycin oxidase TamL in P21 space group [Streptomyces sp. 307-9],2Y3R_B Structure of the tirandamycin-bound FAD-dependent tirandamycin oxidase TamL in P21 space group [Streptomyces sp. 307-9],2Y3R_C Structure of the tirandamycin-bound FAD-dependent tirandamycin oxidase TamL in P21 space group [Streptomyces sp. 307-9],2Y3R_D Structure of the tirandamycin-bound FAD-dependent tirandamycin oxidase TamL in P21 space group [Streptomyces sp. 307-9],2Y3S_A Structure of the tirandamycine-bound FAD-dependent tirandamycin oxidase TamL in C2 space group [Streptomyces sp. 307-9],2Y3S_B Structure of the tirandamycine-bound FAD-dependent tirandamycin oxidase TamL in C2 space group [Streptomyces sp. 307-9],2Y4G_A Structure of the Tirandamycin-bound FAD-dependent tirandamycin oxidase TamL in P212121 space group [Streptomyces sp. 307-9],2Y4G_B Structure of the Tirandamycin-bound FAD-dependent tirandamycin oxidase TamL in P212121 space group [Streptomyces sp. 307-9]
3VTE_A	1.14e-27	38	488	53	510	Crystal structure of tetrahydrocannabinolic acid synthase from Cannabis sativa [Cannabis sativa]
6FYD_A	1.91e-26	18	488	25	459	The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_B The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_C The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_D The crystal structure of EncM T139V mutant [Streptomyces maritimus]
6FYF_A	3.48e-26	18	488	25	459	The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_B The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_C The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_D The crystal structure of EncM V135M mutant [Streptomyces maritimus]
6FYE_A	3.48e-26	18	488	25	459	The crystal structure of EncM H138T mutant [Streptomyces maritimus],6FYE_B The crystal structure of EncM H138T mutant [Streptomyces maritimus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q796Y5|YGAK_BACSU	2.67e-32	15	488	10	442	Uncharacterized FAD-linked oxidoreductase YgaK OS=Bacillus subtilis (strain 168) OX=224308 GN=ygaK PE=3 SV=4
sp|O06997|YVDP_BACSU	6.51e-28	15	488	10	443	Uncharacterized FAD-linked oxidoreductase YvdP OS=Bacillus subtilis (strain 168) OX=224308 GN=yvdP PE=1 SV=1
sp|Q9FZC7|FOX4_ARATH	4.13e-27	26	488	83	546	Berberine bridge enzyme-like 6 OS=Arabidopsis thaliana OX=3702 GN=FOX4 PE=2 SV=1
sp|Q8GTB6|THCAS_CANSA	7.15e-27	38	488	80	537	Tetrahydrocannabinolic acid synthase OS=Cannabis sativa OX=3483 GN=THCAS PE=1 SV=1
sp|Q0CF74|AZPB3_ASPTN	3.48e-26	15	482	41	474	FAD-linked oxidoreductase ATEG_07660 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=ATEG_07660 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000057	0.000000

TMHMM  Annotations     

There is no transmembrane helices in TRIVIDRAFT_49826-t45_1-p1.