CAZyme Information: TRIVIDRAFT_45518-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_45518-t45_1-p1
• CAZy Family: GH2
• CAZyme Description: glycoside hydrolase family 25 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
228	ABDF02000005|CGC2	24254.73	5.9556

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000005:2762295-2763040(+)

Full Sequence      

MKSLASIAVGVAALASVANASVKGFDISNYQPNVDFAKAYSDGARFVIIKATEGTTYIDP
TFSDHYTKATNAGFIRGGYHFAHPGSSSGAAQANYFLQHGGGWSSDGITLPGMLDLEYAP
SGDSCYGLSASAMVSWINDFLNTYHAATSQYPLIYTSTSWWQLCTGNNGSFGNKSPLVVA
RYASSVGTLPNGWSYYTIWQNNDAAPWGGDSDVFNGDLSQLQKIARGS

Enzyme Prediction     

EC	3.2.1.17:41

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	26	205	1.9e-49	0.96045197740113

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119374	GH25_CH-type	1.48e-110	22	221	1	199	CH-type (Chalaropsis-type) lysozymes represent one of four functionally-defined classes of peptidoglycan hydrolases (also referred to as endo-N-acetylmuramidases) that cleave bacterial cell wall peptidoglycans. CH-type lysozymes exhibit both lysozyme (acetylmuramidase) and diacetylmuramidase activity. The first member of this family to be described was a muramidase from the fungus Chalaropsis. However, a majority of the CH-type lysozymes are found in bacteriophages and Gram-positive bacteria such as Streptomyces and Clostridium. CH-type lysozymes have a single glycosyl hydrolase family 25 (GH25) domain with an unusual beta/alpha-barrel fold in which the last strand of the barrel is antiparallel to strands beta7 and beta1. Most CH-type lysozymes appear to lack the cell wall-binding domain found in other GH25 muramidases.
395941	Glyco_hydro_25	3.42e-51	26	210	2	180	Glycosyl hydrolases family 25.
119373	GH25_muramidase	8.50e-47	23	203	1	170	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
119384	GH25_YegX-like	2.01e-39	23	216	1	194	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.
128889	Glyco_25	4.00e-32	22	128	1	109	Glycosyl hydrolases family 25.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ50369.1|GH25	5.96e-169	1	228	1	228
UKZ76790.1|GH25	5.96e-169	1	228	1	228
QYS95465.1|GH25	6.35e-155	1	228	1	228
UKZ86614.1|GH25	2.38e-150	1	228	1	228
UKZ67883.1|GH25	6.26e-146	1	228	1	228

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZM8_A	1.74e-100	22	227	2	207	Chain A, muramidase [Sodiomyces alcalophilus]
6ZMV_A	4.57e-98	21	228	1	207	Chain A, muramidase [Trichobolus zukalii],6ZMV_B Chain B, muramidase [Trichobolus zukalii]
2X8R_A	1.75e-91	21	227	3	210	The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_B The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_C The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_D The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_E The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_F The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293]
1JFX_A	1.12e-64	22	225	5	213	Crystal structure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]
4KRU_A	2.96e-12	21	203	19	191	X-ray structure of catalytic domain of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P00721|LYS_CHASP	2.09e-94	21	227	1	211	N,O-diacetylmuramidase OS=Chalaropsis sp. OX=36534 PE=1 SV=1
sp|D4ANU4|LYS_ARTBC	9.49e-94	21	227	29	234	N,O-diacetylmuramidase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05911 PE=1 SV=1
sp|P25310|LYSM1_STRGL	5.99e-63	22	225	82	290	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1
sp|P76421|YEGX_ECOLI	1.29e-16	18	227	63	267	Uncharacterized protein YegX OS=Escherichia coli (strain K12) OX=83333 GN=yegX PE=3 SV=2
sp|Q8FFY2|YEGX_ECOL6	3.42e-16	18	227	63	267	Uncharacterized protein YegX OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=yegX PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000207	0.999768	CS pos: 20-21. Pr: 0.9792

TMHMM  Annotations     

There is no transmembrane helices in TRIVIDRAFT_45518-t45_1-p1.