CAZyme Information: TRIVIDRAFT_45439-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_45439-t45_1-p1
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
981	ABDF02000005|CGC15	111815.07	5.4671

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000005:2271097-2274101(-)

Full Sequence      

MLEQKVVNFEPGDGFSIVGAEIFVDEQDYTGVHIAANNLSEDFTKVTGQRCNPIVKTRPS
APPARSCIVIGSLTKSPTIQLLKEQGKIDPSQIEGKWESWITTVVHEPFEGYDDALVIAG
SDKRGTIFGIYSLSEQIGVSPWHWWADVPPKKQQQIYALPVTTSNGEPSVKYRGIFINDE
CPGMDSWVHEKFGPTFDANLYHYIFELLLRLKANFMWPAMWRGYPYPGRSFFVDDPKNQE
LADTYGIVMGTSHHEPMQRAMNEWSTTQPGGTWNWDTNKEKVTQYFEEGAERAVPYESYF
TMGMRGEGDVPMTGGDPVKILTEVLSVQRNIIKKNYGKEDGVLQLMALYKEVQGYYEKGL
VIPDDVTLLFGDDNFGNLRRLPTEEENKRSGGSGFYYHFQYTGYPRCYRWINSNTLGKAL
HQLQLAHHRGANRIWVFNVGDLKPVEIPMSFAFDLAWDINSITATTLPQYFEHLATREFG
EKYASRIAKSWYDFNKLVAIRKQDHIDASTFVIQKYHESDNIIARWRELMGETQAIYSYI
DEEHKSAFFQLVLHPVKATYIFTQVRVAQYTNQLFAKQRRNTTNALLKKCISLMDADHDL
FEEYNSISDGKWNLMLRQPHYGYGDTGAEPSRNMIDGLCYVQTREDSNPSVGHMGIAVEG
IEGINPGHINEDSDRTHPSRGGLEPGVTLPFITPYGEQTRYFEVFHRGTQEFSWEARPQY
KWIKLSQYQGHLNPRDDDIRVIITIDWAEVPTDFDAKVMIEIIGTRDGYEQVHMTVRNSR
VPADFEGFVEESGHLAIDAGNWVTAPYIQLPALGRPIAGAVTLPLDTDFSKPDDIPFLKY
PIYVFSQHDNTNLELQFNITLETEKASRMQYDVRFDGGAIKTFRLTEDESNADNLPKNWA
TAVMDCVWKKGHNLGTVKKGSHTIEVRFRSQNICLEKLLIDLGDLRYTYLGPPQSAFVKK
GESQAVNVIGQLDSLKIDLGF

Enzyme Prediction     

EC	3.2.1.131:6

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	20	630	2.3e-227	0.8220946915351507

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406396	Glyco_hydro_115	0.0	166	505	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
407695	GH115_C	1.16e-43	787	953	1	171	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ50214.1|GH115	0.0	1	981	1	981
UKZ76661.1|GH115	0.0	1	964	1	963
QYS95663.1|GH115	0.0	1	981	1	981
UKZ86762.1|GH115	0.0	1	981	1	981
UKZ67706.1|GH115	0.0	1	981	1	981

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZMH_A	5.73e-197	20	955	23	933	Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
4C90_A	2.84e-145	3	623	32	647	Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	3.11e-143	22	674	28	681	Chain A, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	7.18e-140	22	674	27	680	Chain A, xylan alpha-1,2-glucuronidase [uncultured bacterium]
6NPS_A	1.99e-127	19	958	19	966	Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

TRIVIDRAFT_45439-t45_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999365	0.000651

TMHMM  Annotations     

There is no transmembrane helices in TRIVIDRAFT_45439-t45_1-p1.