CAZyme Information: TRIVIDRAFT_45064-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_45064-t45_1-p1
• CAZy Family: GH2
• CAZyme Description: glycoside hydrolase family 55 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
763		82291.57	6.1942

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000087:179262-181840(+)

Full Sequence      

MRFTPFFLGLAAVAAGSSLPAEGIEARHSSGYWYEKIQHNGISPFIPDGKNWKVFRNVKT
DFGAKGDGVTDDWAAIQAAFDYANATEKRSSGAWGTTGAPAVVYIPAGTYRLSKPLQSYV
DTVVMGDPTNRPVLQASSDFTDPFLYLGYDPGYDSTINFYIGLKNVVLDSTKVPLAHNIT
LLNWAVSQAVQLTNVLFNMPIGGVAHTGLSMPQGGSPLMINDVVFQGGSVGIRMNEQQYH
FKGITFKNQDIGLKLDKLFEGTGQGLIFESCKVGIETTNNNTGFFALIDSTAKNVGILWN
AAASPTAQGSMVLENVQVDKTTVTAGGINVLKGSVKPGQSWIWGNVYGPSSGQRAQGKFF
PASRPAALVDITGKYHAVPPPTFQEYSLDQVINVKTVHGLPVAGDGVTDDTKNLQKIINQ
AAGKKVIYFPHGTYLVSDTIVVPPGSRFHGEVWSEISATGNKFKNANKPVPMVQVGKPGQ
LGVAQFVDMLFTVADILPGCELVEVNMAGLKAGDVGFFNTHFRIGGARGSKVQTNCDDPA
TCKAARVCAHLTALSSSYWENSWCWSADHDLDDDNGANPSTAGGFLVESIRATWMLGIGS
EHNSLYQINIYKAQNVFLGFQQSETPYWQGNNSGLLTPLPWTGSLLDSDPDFSWCAPDDA
QCRMAIFQYIHDSSNINAYGGGYWVFFNGINRDGCKAECQQNAVIYADNQKLYSYGVSTH
NVRTMVLESERGKSVAEVVDTANAGGWQSHGGVMAAYLGQSGY

Enzyme Prediction     

No EC number prediction in TRIVIDRAFT_45064-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH55	26	747	6e-201	0.9783783783783784

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403800	Pectate_lyase_3	6.59e-52	55	276	1	213	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
403800	Pectate_lyase_3	5.05e-06	392	441	2	51	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
227721	Pgu1	1.85e-04	60	116	86	129	Polygalacturonase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ54260.1|GH55	0.0	1	763	1	763
UKZ80036.1|GH55	0.0	1	763	1	756
QYT01944.1|GH55	0.0	1	763	1	766
UKZ93151.1|GH55	0.0	1	763	1	766
UKZ66108.1|GH55	0.0	1	763	1	765

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3EQN_A	1.08e-121	32	719	26	724	Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQN_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_A Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium]
5M5Z_A	1.77e-113	30	743	4	744	Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila],5M60_A Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila]
7CHU_A	9.24e-06	27	114	43	126	Chain A, Putative pectin lyase [Geobacillus virus E2],7CHU_B Chain B, Putative pectin lyase [Geobacillus virus E2],7CHU_C Chain C, Putative pectin lyase [Geobacillus virus E2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4B0V1|E13B_ARTBC	4.60e-117	8	732	19	855	Probable glucan endo-1,3-beta-glucosidase ARB_02077 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02077 PE=1 SV=1
sp|P49426|EXG1_COCCA	9.43e-114	18	734	34	768	Glucan 1,3-beta-glucosidase OS=Cochliobolus carbonum OX=5017 GN=EXG1 PE=1 SV=1
sp|P53626|E13B_TRIHA	3.63e-100	8	757	12	760	Glucan endo-1,3-beta-glucosidase BGN13.1 OS=Trichoderma harzianum OX=5544 GN=bgn13.1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000299	0.999662	CS pos: 27-28. Pr: 0.6507

TMHMM  Annotations     

There is no transmembrane helices in TRIVIDRAFT_45064-t45_1-p1.