CAZyme Information: TRIVIDRAFT_41602-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_41602-t45_1-p1
• CAZy Family: GH18
• CAZyme Description: polysaccharide lyase family 7 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
250	ABDF02000089|CGC13	26464.64	5.5912

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000089:1291294-1292046(+)

Full Sequence      

MAPKSIISLLALLPATAVLALNPSCAPGGNFNLSVWSLQLPTGSGDSVDTIKSKDLQGCS
GYTGPTFFTDKSNGELILTAPGNPDITGCSHTSGSEHCRTELREVDPKSGKNTDWPPTGT
NTLTVQMKVVKADDGSHGTAIGQVFAAAASKPLAEMYYSTKGDIVVGVKESPDDNQIVTK
LGNVPVGTYFTYVMSYSDDVLSISINGKKTTLSTYDWDSPNCYFKSGNYNQGKTAVTSEV
HIRSIDVVHS

Enzyme Prediction     

No EC number prediction in TRIVIDRAFT_41602-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL7	31	249	9.3e-62	0.9953271028037384

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400923	Alginate_lyase2	1.68e-39	31	249	1	222	Alginate lyase. Alginate lyases are enzymes that degrade the linear polysaccharide alignate. They cleave the glycosidic linkage of alignate through a beta-elimination reaction. This family forms an all beta fold and is different to all alpha fold of pfam05426.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ55716.1|PL7_4	2.24e-184	1	250	1	250
QYT00320.1|PL7_4	5.86e-171	1	250	1	250
UKZ81480.1|PL7_4	3.36e-160	1	220	1	220
OTA00986.1|PL7_4	6.34e-155	1	249	1	249
UKZ71163.1|PL7_4	1.15e-154	1	250	1	249

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7NDE_A	4.98e-146	21	249	3	231	Chain A, Glucuronan lyase [Trichoderma parareesei]
2ZA9_A	2.30e-17	23	250	1	227	Chain A, Alginate lyase [unidentified]
2CWS_A	2.28e-16	23	250	2	228	Crystal structure at 1.0 A of alginate lyase A1-II', a member of polysaccharide lyase family-7 [Sphingomonas sp. A1],2Z42_A Crystal Structure of Family 7 Alginate Lyase A1-II' from Sphingomonas sp. A1 [Sphingomonas sp.]
2ZAA_A	8.19e-16	23	250	1	227	Chain A, Alginate lyase [Sphingomonas sp. A1]
2ZAB_A	8.19e-16	23	250	1	227	Chain A, Alginate lyase [Sphingomonas sp. A1],2ZAC_A Chain A, Alginate lyase [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59478|ALYA_KLEPN	3.87e-07	26	234	24	285	Alginate lyase OS=Klebsiella pneumoniae OX=573 GN=alyA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000235	0.999747	CS pos: 20-21. Pr: 0.9683

TMHMM  Annotations     

There is no transmembrane helices in TRIVIDRAFT_41602-t45_1-p1.