CAZyme Information: TRIVIDRAFT_36446-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_36446-t45_1-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
597	ABDF02000005|CGC9	65320.53	5.3499

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000005:287478-289402(-)

Full Sequence      

MQIVSINDFIRQSFDFLVIGGGTAGLVVASRLAQDGKYTVGVLEAGGTANGREDVQIPGY
LAMSLGSEIDWKFQTAPQTGLGGRSVSWPRGKALGGSSAINFMTWMRGAREDYDGWEALG
NSGWGWNELLPYFKKSETFHTPSDSIRDEEDLRYDPEAFGDSGPIHISYAKEYSPSNRHW
FKALNSLGVPTNSAHFAGSNVGAWTNVNNIDPRTMTRSFATNYCSLAGSNLHILTDATVQ
EVILDNIDNECVASGVRFTYKGEEHVALASREVILSAGSIKSPQILELSGIGNPEILSRA
GIAVKVDSPMVGENLQDHNAVHIIAEVDPELENRDDLFFDANYAAEAREQYRRDQTGPLA
SIPSSYTFVPLASFMSQDTLERLHSQAQALTGFSPAKKTLMEQRLRHADRFGYAEYIFRL
GAAPMAVTGKKFGTLFQILQYPFAVGSIHIQPPAAEGDDPVIDPRHYHGPRGEIDLEVMM
ESTRFARDILLAPAFSSVVKQIFHPPASSYANDEYMKKWITDSTAVAFHPVGTCAMGGHE
GIRGGVVDERLKVYGVKKLRVVDASIMPLQISAHIQATVYAIAEKASSMILEDVAQN

Enzyme Prediction     

No EC number prediction in TRIVIDRAFT_36446-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	12	593	2.3e-182	0.9982394366197183

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	7.85e-106	13	593	7	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.75e-96	12	591	4	532	choline dehydrogenase; Validated
366272	GMC_oxred_N	1.13e-39	82	318	15	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	2.55e-33	442	586	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	2.41e-21	12	593	54	579	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ49614.1|AA3_2	0.0	1	545	1	545
QYS96342.1|AA3_2	0.0	1	596	1	596
UKZ66990.1|AA3_2	6.69e-277	1	594	1	594
UKZ87414.1|AA3_2	3.85e-276	1	595	1	595
UNI22347.1|AA3_2	1.37e-236	4	594	12	610

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	1.62e-76	13	593	5	567	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6ZE2_A	1.19e-72	10	593	2	585	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
4H7U_A	1.09e-67	14	590	41	597	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
3Q9T_A	6.71e-65	14	590	7	569	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	9.33e-65	14	590	7	569	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A142PTM2|CITC_MONPU	1.65e-96	1	593	1	611	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A161CEV4|CITC_MONRU	1.65e-96	1	593	1	611	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	2.09e-87	1	593	1	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|M5EAX2|GMCH_MALS4	1.64e-84	8	591	41	616	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	1.64e-84	8	591	41	616	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.997547	0.002465

TMHMM  Annotations     

There is no transmembrane helices in TRIVIDRAFT_36446-t45_1-p1.