CAZyme Information: TRIVIDRAFT_32988-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_32988-t45_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
259		29291.38	4.8989

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000003:2451079-2451858(+)

Full Sequence      

MGVIKSLTVALAALPLSIATQTFQNGGTKAGFDYVLTENKGQVLEVSDITYKGTSALLMQ
QTFTPGYQGRYHSEVYHNQGYKRGDELFYGFMFRLSSSWEFDKQSYNIAQFIADRPGAGC
DGDDWMPSSLIWLEGNQLNSRIVSGNYRQPDCSRSFTGTGNIATVSAGVWHKVIIQAKWA
SDSSGYYKMWFDNNKVYEHYNIATTTNDDYEFAFRVGLYANGWHDDNHSMVGNQGFRQIW
YDEVAVGTTFKDVDPDQYE

Enzyme Prediction     

EC	4.2.2.14:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL20	23	258	7.8e-101	0.9956331877729258

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404905	Polysacc_lyase	1.42e-72	25	245	2	213	Polysaccharide lyase. This family includes heparin lyase I, EC:4.2.2.7. Heparin lyase I depolymerizes heparin by cleaving the glycosidic linkage next to an iduronic acid moiety. The structure of heparin lyase I consists of a beta-jelly roll domain with a long, deep substrate-binding groove and an unusual thumb domain containing many basic residues extending from the main body of the enzyme. This family also includes glucuronan lyase, EC:4.2.2.14. The structure glucuronan lyase is a beta-jelly roll.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ48319.1|PL20	6.00e-198	1	259	1	259
UKZ74856.1|PL20	6.00e-198	1	259	1	259
QYS97804.1|PL20	6.95e-188	1	259	1	259
OSZ99920.1|PL20	3.99e-180	1	259	1	258
UKZ91352.1|PL20	2.37e-172	1	259	1	258

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2ZZJ_A	3.15e-125	20	257	1	237	Chain A, Glucuronan lyase A [Trichoderma reesei]

Swiss-Prot Hits     

TRIVIDRAFT_32988-t45_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000337	0.999626	CS pos: 19-20. Pr: 0.9794

TMHMM  Annotations     

There is no transmembrane helices in TRIVIDRAFT_32988-t45_1-p1.