CAZyme Information: TRIVIDRAFT_32109-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_32109-t45_1-p1
• CAZy Family: GH16
• CAZyme Description: glycoside hydrolase family 5 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
458		48467.71	7.2914

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000003:2431402-2432843(-)

Full Sequence      

MAFKQLLIVANAAALCAAQTTITVNVGTKFQQIDGFGFSQAFGRASEFQNANANTQKQAL
DYLFSTSTGAGFSIIRNRIGSGGAGDSIEPNNPGSPSAAPKYTWDNNDSGQLWFTKQAVS
YGVKTIYADAWGAPGFMKTSGSDSSPGYLCGTTGHSCSSGDWRQAYANFLVQYVKYYAAA
GYNITHLGFLNEPDFQTTYSQMQISSNAQEAISFIPILYNTVKAAGLSTQITCCDAVGWT
TQSTYTTNLVNAGSTQYLGIITSHSYSADATSPLSQTSLRKWNTEGGPSTAFVTTWYGSG
GTNEGFTWANKLAVAMVNAQLSAYLFWEGFEIQQSQSGSHLIDALDRQTATPSGIFWAFA
MWSRYIRPGAFRVAASGSISNVIIGAFQNLDGSVVVVFTNSGSSTQSARVAFTGFSPSSA
AAYVTDNSHTFASTSSGLSSGAITVSVPSKGVVTVKLT

Enzyme Prediction     

EC	3.2.1.8:3	3.2.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	19	455	2.2e-178	0.9932279909706546

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227807	XynC	1.27e-19	22	454	36	425	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].
405300	Glyco_hydr_30_2	4.25e-12	21	305	3	317	O-Glycosyl hydrolase family 30.
407314	Glyco_hydro_30C	2.85e-05	369	410	1	43	Glycosyl hydrolase family 30 beta sandwich domain.
396577	Glyco_hydro_59	3.22e-05	56	327	24	251	Glycosyl hydrolase family 59.
307945	Glyco_hydro_30	1.83e-04	126	193	96	158	Glycosyl hydrolase family 30 TIM-barrel domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ48328.1|GH30_7	0.0	1	458	1	458
QYS97800.1|GH30_7	1.03e-301	1	458	2	459
UKZ91355.1|GH30_7	6.63e-299	2	458	7	463
UKZ65967.1|GH30_7	3.67e-295	2	458	3	459
EGR45006.1|GH30_7|3.2.1.-	1.74e-293	1	458	2	459

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6M5Z_A	9.77e-145	15	458	18	454	Chain A, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612],6M5Z_B Chain B, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612]
7O0E_A	4.76e-112	18	457	1	447	Chain A, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464],7O0E_G Chain G, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
7NCX_AAA	9.53e-111	18	457	8	454	Chain AAA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
6IUJ_A	2.65e-102	1	410	1	421	Chain A, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612],6IUJ_B Chain B, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612]
6KRL_A	4.50e-100	22	410	95	492	Crystal structure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris [Saccharomyces uvarum],6KRN_A Crystal structure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris in complex with aldotriuronic acid [Saccharomyces uvarum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2Q1N4|XY30A_MYCTT	6.63e-112	18	457	25	471	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1
sp|O16580|GLCM1_CAEEL	7.37e-06	22	403	87	484	Putative glucosylceramidase 1 OS=Caenorhabditis elegans OX=6239 GN=gba-1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000275	0.999663	CS pos: 18-19. Pr: 0.9502

TMHMM  Annotations     

There is no transmembrane helices in TRIVIDRAFT_32109-t45_1-p1.