CAZyme Information: TRIVIDRAFT_31131-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_31131-t45_1-p1
• CAZy Family: GH16
• CAZyme Description: carbohydrate esterase family 8 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
328		34512.32	6.8414

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000004:1296434-1297488(+)

Full Sequence      

MFKIKALAALLAFTVSTFAASRTSPPAGALVVGPGFYSTVQAAVNALKSTSQEQIIFINP
GTYNEQVTINKLAGPLTIYGYTQNTASYASNTVTIAASHSLLDEATDDATGTLRVETTNF
KLYNVNVVNSHGSGSQALAVSANAGNQGYYACSFKGFQDTLLAETGAQLYSRCYIEGATD
FIFGQQATAWFEKCTIGVLPASIGYITASGRTSNSASYYVFNGATIGAAPGKSVTSGVYY
LGRPWGDYARVAYQSCSMSNVINGAGWHIWNTGDERTDHVSFGEYSNSGAGASGIRASFA
TKLSSALTIGSILGSSYASQYYVDTSYL

Enzyme Prediction     

EC	3.1.1.11:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	34	303	2e-74	0.9131944444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395871	Pectinesterase	2.19e-43	33	293	8	267	Pectinesterase.
178372	PLN02773	2.35e-43	24	292	1	270	pectinesterase
178051	PLN02432	1.30e-42	33	317	19	291	putative pectinesterase
215357	PLN02665	9.60e-40	33	317	76	359	pectinesterase family protein
215367	PLN02682	5.12e-38	16	304	56	348	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ54885.1|CE8	3.32e-216	1	328	1	328
QYT01220.1|CE8	3.02e-196	1	328	1	328
UKZ80666.1|CE8|GH5_7	5.51e-180	1	285	1	285
UKZ90554.1|CE8	5.38e-176	7	328	7	328
UJO19307.1|CE8	3.87e-147	5	328	2	325

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	1.99e-55	21	327	2	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	2.81e-55	21	327	2	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	3.41e-19	33	292	15	273	Pectin methylesterase from Carrot [Daucus carota]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12535|PME_ASPAC	4.04e-86	4	327	2	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|P17872|PME_ASPNG	2.29e-85	4	328	2	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q4WBT5|PMEA_ASPFU	3.13e-60	21	327	27	324	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|B0Y9F9|PMEA_ASPFC	3.13e-60	21	327	27	324	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1
sp|A1DBT4|PMEA_NEOFI	8.78e-60	21	327	27	324	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000513	0.999466	CS pos: 19-20. Pr: 0.9783

TMHMM  Annotations     

There is no transmembrane helices in TRIVIDRAFT_31131-t45_1-p1.