CAZyme Information: TRIVIDRAFT_30947-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_30947-t45_1-p1
• CAZy Family: GH16
• CAZyme Description: glycosyltransferase family 22 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
482	ABDF02000004|CGC2	54717.68	8.5880

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000004:1554144-1556002(-)

Full Sequence      

MWRRTYLLLVLIRLYFALSPSYLHPDENFQGPEVIAGQIFSYPVRHTWEFTSETPIRSVF
PLWPVYGLPMLLLRWLWVGNGQDGEVPPIAVFWTLRCLMFLLSFVLEDWAIHEQITSTRH
RRIAVLLVASSYVTWTFQTHTFSNSIETLAVLWSLVLIERIMDPHTTSINSSSPFSLAAL
VLAALTTALTAIAVDTAFYTPGPITWSDLITNPVITPINNLVYNSNPENLALHGLHPWYQ
HILGNLPQLIGPAAALLFLRPHVSLRLWSAVSGIIVLSFIKHQEARFLLPSVPLILSSLQ
LPKNKALLRTWTAIWVIFNLFFGVLMGTYHQGGIVPGQVFMSKQPDATNAIWWKTYPPPI
WLLNGKNEVLTTKDVMGIKGEELLKQLAELATCDTPADRRNTEYLKEKNGTYLLAPASAT
WLDPYLPNKGLEGLRFREVWRYRNHLNLDDLDFGDDGVWNTLSRVIGRRGLVAWRVTKSC
GL

Enzyme Prediction     

EC	2.4.1.-:4	2.4.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT22	5	362	2.4e-65	0.9897172236503856

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
281842	Glyco_transf_22	2.44e-37	5	361	2	410	Alg9-like mannosyltransferase family. Members of this family are mannosyltransferase enzymes. At least some members are localized in endoplasmic reticulum and involved in GPI anchor biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ54961.1|GT22	0.0	1	482	1	482
UKZ86010.1|GT22	1.27e-312	1	482	1	521
QYT01138.1|GT22	1.94e-307	37	482	34	512
UNI14407.1|GT22	6.98e-297	1	480	1	515
QLI65346.1|GT22	1.11e-290	1	480	1	515

PDB Hits     

TRIVIDRAFT_30947-t45_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4I785|SMP3_GIBZE	8.20e-285	1	480	1	515	GPI mannosyltransferase 4 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=SMP3 PE=3 SV=2
sp|Q2UTP0|SMP3_ASPOR	1.17e-157	1	479	1	540	GPI mannosyltransferase 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=smp3 PE=3 SV=1
sp|Q5BAX7|SMP3_EMENI	1.24e-152	1	474	1	534	GPI mannosyltransferase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=smp3 PE=3 SV=2
sp|Q4WTT7|SMP3_ASPFU	3.33e-150	1	474	1	539	GPI mannosyltransferase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=smp3 PE=3 SV=2
sp|Q6CDD0|SMP3_YARLI	1.54e-83	10	452	13	495	GPI mannosyltransferase 4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=SMP3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.002352	0.997633	CS pos: 17-18. Pr: 0.9399

TMHMM  Annotations     

Start	End
59	78
89	111
123	142
172	194
313	335