CAZyme Information: TRIVIDRAFT_30821-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_30821-t45_1-p1
• CAZy Family: GH15|CBM20
• CAZyme Description: glycoside hydrolase family 2 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
870		98432.25	5.3694

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000004:1099833-1102522(+)

Full Sequence      

MATYLRTDVHDGWVFKQADKPDSDFRPVAQFPTVIHLDLLHHNLIPDPPKDRNSELIQWV
GEKQWLYKTSFISPQAPSSTGKVSHTMVFDGLDTYAKISLNGKEIASTANMFLQYRVDAT
EALKPAGEENSLELLFDSAFLEGKRLEKAQGYKNLFWNGDSCRMNVRKIGCHFGWDWAPT
LLTCGPWRPIYLESFVTRIADVNIDIDVADSLDVAIVTVTPELQGHDGNDKSVQVSISSP
DGEAVFTGNGSSSATLKDPKLWYPVGYGKQPLYTVTATLGDQQVVRKVGIRHLRLVQRPL
ENGAPGTTFFFQVNQIPIYCRGANWVPGDTFLPRINAKRYRQWIELALHGNQNMIRVWGG
GLYEDDSFYEICDELGILIWHDFQLGCGVYPVSDFMTNTIREEAIYNLKRLRHHPSIVLW
CGNNEDHMFAELHHLEYDINDKNPDNWLKTNWAARWYYDKMLPDICAELVPRVPYHNSSP
WGGTYSNDPTVGDIHSWRVWMADQPRYPYQDYEKLTGRFVSEFGMKSSPSVHSVRQLITD
PAERHPQSRTFDNWFCAPEDQRTLSMYLIDNQKYDIASLQAYVYATQLNQAEATDYSLRP
FRRLWKGPGQEECAGSLIWQLNDCFPAASWSLADAFLRPKLAYFVAKRDFAPIIVGCART
TVEHPADEFTRVFVERVTSADVWASNCTTSEVKLTITVAFYSVLDGKLLASKSEEVTLPP
NRSTELQKVNFDEKEWGVKQESVVVATKLTKNGDVLARYVNFPQPLRHLDFSAAEVTVTK
KEINDSTRSFELAVSVMNGAAKGVELMIDTLDPDVADSYVFSDNALDLVPGEEQIVTVTA
VAGTKADLEKVKVVEQHYGSVATKQSLVLM

Enzyme Prediction     

EC	3.2.1.25:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	6	748	3.3e-85	0.7167553191489362

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	1.63e-67	6	652	12	631	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
407658	Mannosidase_ig	7.61e-19	678	768	1	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
395572	Glyco_hydro_2	2.10e-10	197	291	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
236673	ebgA	2.90e-10	89	425	132	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
407625	Ig_mannosidase	6.09e-05	774	854	2	72	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ54830.1|GH2	0.0	1	870	1	870
UKZ80613.1|GH2	0.0	1	870	1	870
QYT01280.1|GH2	0.0	1	870	1	870
UKZ59406.1|GH2	0.0	1	861	1	861
UKZ85848.1|GH2	0.0	1	862	1	863

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	1.60e-127	13	787	33	770	Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
6BYE_A	9.04e-107	29	842	35	836	Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	9.24e-107	29	842	35	836	Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	6.33e-106	29	842	33	834	Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	6.47e-106	29	842	35	836	Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|I2C092|MANBB_THETO	6.34e-255	1	847	1	844	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1
sp|A1CGA8|MANBB_ASPCL	5.02e-209	1	849	1	839	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
sp|Q0CCA0|MANBB_ASPTN	2.11e-207	1	852	1	837	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
sp|A1D911|MANBB_NEOFI	3.55e-206	1	849	1	839	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1
sp|Q4WAH4|MANBB_ASPFU	3.55e-206	1	849	1	839	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000051	0.000000

TMHMM  Annotations     

There is no transmembrane helices in TRIVIDRAFT_30821-t45_1-p1.