CAZyme Information: TRIVIDRAFT_30599-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_30599-t45_1-p1
• CAZy Family: GH154
• CAZyme Description: glycosyltransferase family 90 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
529	ABDF02000004|CGC12	61747.43	6.2088

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000004:1090348-1092010(+)

Full Sequence      

MKDAQHEFAEVKKRQSKSLGEAVKEYRRRYGMPPPPHFDKWYKFAVSNKVHLIDEFDMIY
DMMTPFWGLQPQTIRARVAEALGYDNGLLGVAIRDHGIAHMEHGYEWQRNATKGMMEKFI
QYLPDMDLAFNIHDEPRVVVPHDDLIRLVNKAKDENMASLNGKNKLVNEFSTKPSDLSDG
KTFKETKLSRFSTIQYQSTWADSRMSCPPDSQARILEDERADDLSRYGISDLAFVYNTTA
MSDICLTPSLSSTYGFFDRPNSFKITHDLLPIFSQSKISSYGDIIYPSPWYWYKKVAYNE
TNDMPWEDKENKLYWRGSTTGGYSRNGGWRRHHRQHFVQKINSKEQAKVMTNSGTAESPK
WTPREVPRGDYQKLIDVHFSHVGQCDPGDCEAQKEFFDVVDPVDQQDAWGYKYLVDIDGN
AFSGRFYAFLQSQSLTFKLALFREWHNEWLKPWVHYVPLSLQGDDWLEAVRFIDEDTKGS
AEGQKIAMESREWANKAIRKEDMEVWFFRLLLEYGRVIDDNRENLGFEI

Enzyme Prediction     

No EC number prediction in TRIVIDRAFT_30599-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	248	518	2.5e-85	0.98

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	7.31e-21	267	516	28	251	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	1.84e-10	271	516	108	321	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.
405255	USP7_C2	0.007	8	65	141	189	Ubiquitin-specific protease C-terminal. This C-terminal domain on many long ubiquitin-specific proteases has no known function.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ54826.1|GT90	0.0	1	529	23	551
UKZ80609.1|GT90	0.0	1	513	96	608
QYT01287.1|GT90	0.0	1	529	105	633
UKZ85843.1|GT90	0.0	2	529	103	629
UKZ59411.1|GT90	0.0	1	529	103	630

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	1.43e-09	248	521	95	345	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	3.03e-48	1	524	158	662	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|G3V9D0|PGLT1_RAT	1.55e-09	248	521	123	373	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|Q8NBL1|PGLT1_HUMAN	8.52e-09	248	521	123	373	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1
sp|B0X1Q4|RUMI_CULQU	1.18e-08	245	518	117	389	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q8BYB9|PGLT1_MOUSE	3.52e-08	248	521	123	373	Protein O-glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Poglut1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000000

TMHMM  Annotations     

There is no transmembrane helices in TRIVIDRAFT_30599-t45_1-p1.