CAZyme Information: TRIVIDRAFT_231261-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_231261-t45_1-p1
• CAZy Family: GT69
• CAZyme Description: glycosyltransferase family 32 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
431		48469.30	6.3138

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000082:72143-73687(+)

Full Sequence      

MLLPHSLFRRRLRLMLLSALAFAAALLFFSGGQRKETPQFDARLLEQQYPLVWSRIHSFD
GVGGAWFIPPGWLADDQRPPENIVEAAILASKAALLARERQAAFSNIPLLMHQTGASSKV
NTWKPDVVPWVEQWLEYSTSPDNSAPMAYFFWDDEGIAMVMDKYEKEFVEDFNSIFTPVE
KADIFRVLTCQYFGGVYADIDTEPLRHPADWVGPSDLARWIDDITGKSYGFKKPDEEAAA
DGKQPVNLIWGLEADTDPNTNTYWRMGYTYPIQLTQWALASAPGHPALRQFMENLRAEVH
LQKNATTYDPNRADPLTRTGPAAVTLATLLWLERDFGFRWNALTGLKDGGKSKLVADALI
LPITGFSPGRGSYGNMGSKPITDPDARLVHHALGSWRKFDLLVEYGKFCRTVFGLCKDWT
KVPAPRPQIGL

Enzyme Prediction     

No EC number prediction in TRIVIDRAFT_231261-t45_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	9.04e-11	107	322	82	261	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	9.66e-07	149	211	20	86	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ53117.1|GT32	0.0	1	431	1	431
UKZ78951.1|GT32	0.0	7	431	275	699
QYT03156.1|GT32	6.08e-292	1	426	1	430
UKZ97010.1|GT32	5.57e-262	1	431	1	430
UKZ97011.1|GT32	2.64e-205	111	431	1	319

PDB Hits     

TRIVIDRAFT_231261-t45_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	9.54e-29	153	397	179	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P31755|OCH1_YEAST	2.43e-10	181	297	169	284	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P47124|HOC1_YEAST	2.52e-09	167	367	184	362	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998769	0.001261

TMHMM  Annotations     

Start	End
12	31