CAZyme Information: TRIVIDRAFT_222410-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_222410-t45_1-p1
• CAZy Family: GH11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
687	ABDF02000006|CGC9	74501.45	6.1890

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000006:3375833-3378019(+)

Full Sequence      

MKLLLALLNGLFIVPAILAAPHARTKRGEKPVGKVDPETASDCTYWEEKTDASVTCDSLQ
AAWSISANDFREWNPLVKDDCSGMKIDNSYCVEVNFGLPRSTTTQPTTVPSATSTDNGVI
TPTPTQPNMVDNCNKFYLVKEDESCADIASANGISVEDFGKWNPKVGAQCTGLWAKTYAC
VGVLGSTGSSTAVPSTTTTTGNGVVTPTPTQPGMVDNCNKFYFVKEGDGCADIITNSGIS
MEDFAKWNPKVGPKCTGLWAKTYTCVGILGSQTGKPTAPAPPNAVKTPSPIQPDMINSCN
RFHFVESGQSCQDIASRYGVTVSELTNWNPKTGSDCSRIFGQTWACVDPIRRFSFDDGTK
NQWIVAEGGADTSSKALAMTSFSNKAYYDVNFNDVAFEARVTLRAGRSGNAGIMFRASDI
GKGADQYRGYYAGVNLAGDLVLGRANNDWRELGRAKVGVSADRPFTIKALATGDQIAVYV
NNVDRPALTVRDGTFRSGKVGVRTHETEAVFDDLFVSTVVFDDFERNLINWQIYDGGFDA
RTRELVASDVTSGKIAYQATFEDFVLEADVALTHSGNNRNAGFLFRTTDVGNGPDAYKGY
YVGIDASSRVLLGRTGGGWKQLDQNNVSIRVNQKYRLRVRAIGDSINVWVDGNPYIQYRD
STYKKGMAGVRIYSTGAVIDNFTIQKI

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM66	527	681	7.9e-27	0.9806451612903225
CBM66	370	513	3e-25	0.9096774193548387

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399445	DUF1080	1.49e-13	518	684	3	181	Domain of Unknown Function (DUF1080). This family has structural similarity to an endo-1,3-1,4-beta glucanase belonging to glycoside hydrolase family 16. However, the structure surrounding the active site differs from that of the endo-1,3-1,4-beta glucanase.
212030	LysM	1.18e-08	301	343	1	42	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
399445	DUF1080	3.74e-08	355	516	6	181	Domain of Unknown Function (DUF1080). This family has structural similarity to an endo-1,3-1,4-beta glucanase belonging to glycoside hydrolase family 16. However, the structure surrounding the active site differs from that of the endo-1,3-1,4-beta glucanase.
212030	LysM	2.17e-07	135	176	1	42	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
197609	LysM	2.98e-07	302	343	1	41	Lysin motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ48216.1|CBM50|CBM66	0.0	1	687	1	687
UKZ88268.1|CBM50|CBM66	0.0	1	687	1	685
UKZ74755.1|CBM50|CBM66	3.67e-293	288	687	4	403
UKZ69150.1|CBM50|CBM66	1.22e-279	295	687	1	393
UKZ74754.1|CBM50	2.60e-201	1	279	1	279

PDB Hits     

TRIVIDRAFT_222410-t45_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4ALG0|LYSM1_ARTBC	5.23e-88	19	350	20	374	LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05157 PE=1 SV=1
sp|D4AZ68|LYSM3_ARTBC	2.14e-14	35	347	32	406	LysM domain-containing protein ARB_01488 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01488 PE=3 SV=1
sp|D4AVW3|LYSM5_ARTBC	1.54e-13	98	347	239	534	LysM domain-containing protein ARB_00327 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00327 PE=3 SV=2
sp|D4B4P8|LYSM2_ARTBC	1.02e-11	142	270	38	183	LysM domain-containing protein ARB_03438 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03438 PE=3 SV=1
sp|D4B5F9|PGDA_ARTBC	2.30e-11	96	183	340	437	Probable peptidoglycan-N-acetylglucosamine deacetylase ARB_03699 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03699 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000240	0.999770	CS pos: 19-20. Pr: 0.9808

TMHMM  Annotations     

There is no transmembrane helices in TRIVIDRAFT_222410-t45_1-p1.