CAZyme Information: TRIVIDRAFT_216354-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_216354-t45_1-p1
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
592		66090.28	6.2390

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000079:568868-570646(-)

Full Sequence      

MPPQNTVPIQSNKMGVKDGDHFDFIVVGGGTAGNCVAGRLAENSKVRILVIEAGVGNPEE
LPEITTPSNAMNLRNSAHDWSYKTTMVRRDDYERIEKPNTRGKMLGGSSSLNYFTWVPGC
KPTFDRWAEWGGKEWTWDPLVPYLRKSATYHDDPKLYKPELKKIGGGGPIHISHAELIDE
MAPFRDNLTKAWVSRGEPLTENIYDGEMNGLYHCVDTIYKGVRSGSYLFLKNKPNITVLA
ETHAKKLLINYADRICRGVRVMTPDGKDINVYADREVILSEGVFESPKLLMLSGVGPARE
LAKFDIDVIVDSRHVGQNLMDHPAVPFVLRVKDSIGMDTKALRQGPENQRIHAAYKKDHS
GPVGSGFLEMVGFPRIDKYLQNDETYNKAKAANGGLDPFSPEGQPHFELDFVCLWGSAFQ
WHYPFPKEGEHTTVVVDLVRPVSGPGEVTLRSSDPLEQPDINLNFFESDLDIIAMREGIR
FSYDVLTKGDGFKDCVIAESPWEMPLHSEEEMKRVVLDRCQTAFHPVGTARLSKSIDQGV
VDPALKVHGVSKLRVIDASVIPLIPDCRIQNSVYMVAEKGADLIKADHKDIY

Enzyme Prediction     

No EC number prediction in TRIVIDRAFT_216354-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	21	587	8.4e-146	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	3.52e-84	21	585	5	532	choline dehydrogenase; Validated
225186	BetA	1.58e-77	21	589	7	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	4.13e-36	446	579	5	142	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	5.46e-23	6	576	39	568	Protein HOTHEAD
366272	GMC_oxred_N	8.54e-22	101	324	23	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ53071.1|AA3	0.0	14	592	1	579
UKZ78908.1|AA3_2	0.0	14	592	1	579
QYT03200.1|AA3_2	0.0	1	592	1	594
UKZ97052.1|AA3	0.0	1	592	1	596
UKZ64141.1|AA3_2	0.0	15	592	6	583

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5ZU2_A	0.0	18	592	3	577	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	0.0	18	592	3	577	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
3Q9T_A	0.0	18	592	3	577	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5OC1_A	3.12e-69	22	587	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.68e-68	22	587	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q988C9|4PADH_RHILO	1.13e-59	20	584	5	533	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q8BJ64|CHDH_MOUSE	4.34e-58	20	585	41	574	Choline dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Chdh PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	4.74e-57	22	588	14	620	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|Q6UPE0|CHDH_RAT	2.27e-56	20	585	44	577	Choline dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Chdh PE=1 SV=1
sp|Q95NZ0|EO_SPOLI	4.35e-56	4	590	33	598	Ecdysone oxidase OS=Spodoptera littoralis OX=7109 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999840	0.000213

TMHMM  Annotations     

There is no transmembrane helices in TRIVIDRAFT_216354-t45_1-p1.