CAZyme Information: TRIVIDRAFT_216235-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_216235-t45_1-p1
• CAZy Family: GH10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
235	ABDF02000072|CGC1	25552.81	8.4708

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000072:87969-88676(-)

Full Sequence      

MKFFTLASVLGLAAMAQAHMELSWPYAFRSKFNPNVPEPLRDYSMTSPLLQAGGNYPCKG
YQVDFNKPEGKSVVTWTAGGTYNLTLSGTATHEGGSCQVSLSYDQAKTWKVVHSWIGQCP
LKPTWSFTLPNDTPAGDAIFSWTWFNKIGNREMYMNCAHVTIKARTGFAARSPSDPYNGR
PSQFVANVNNGCGTLEGKDLLFPNPGPDTDFSSSGTAPPTGTCNTGKRFAQPLTV

Enzyme Prediction     

No EC number prediction in TRIVIDRAFT_216235-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA11	36	212	1.1e-64	0.9424083769633508

CDD Domains     

TRIVIDRAFT_216235-t45_1-p1 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ47133.1|AA11	2.25e-181	1	235	1	235
UKZ73707.1|AA11	9.19e-181	1	235	1	235
QYS93776.1|AA11	4.14e-161	1	235	1	234
UKZ60083.1|AA11	1.93e-148	6	235	4	235
UKZ85262.1|AA11	1.58e-147	6	235	4	235

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MAH_A	8.49e-31	41	212	12	202	Structure of Aspergillus oryzae AA11 Lytic Polysaccharide Monooxygenase with Zn [Aspergillus oryzae],4MAI_A Structure of Aspergillus oryzae AA11 Lytic Polysaccharide Monooxygenase with Cu(I) [Aspergillus oryzae]

Swiss-Prot Hits     

TRIVIDRAFT_216235-t45_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000190	0.999800	CS pos: 18-19. Pr: 0.9794

TMHMM  Annotations     

There is no transmembrane helices in TRIVIDRAFT_216235-t45_1-p1.