CAZyme Information: TRIVIDRAFT_200353-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_200353-t45_1-p1
• CAZy Family: CE4
• CAZyme Description: glycoside hydrolase family 3 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
964	ABDF02000005|CGC9	104776.93	6.5761

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000005:2709121-2712355(-)

Full Sequence      

MLLKHWKAAAFLAISAASHVDAGFLNFEGLAKRSNDGTATKPQNKDQFIDSLISKMTVSD
LVLQLHLMFGDDIVGKDSHNELYDQTMHLSPTSPIGVIHDWYPMNKSFFNSIQKLQLDKS
HIKVPMMLVEECLHGVGSFKQSLFPQNIAMAATFDTDIVYRIGRAIGTEARSIGIHGCFS
PVLDLAHDPRWGRVQETFGEDKVLTSHIGVAYSSGLSKNKSWSDPDAVYPIMKTNQHFAA
HGAAQAGHNTAPFTGLGTRQIMEDLLVPFKANYELGGARGAMMAYNEIDGIPAAVHPMLY
QTLEDWNFDGFTLADDTCMRNILTQHRVANSQADAMQQWFNAGGMIDFYDWDLDSYLTIT
KDLVANGTVPLKTLQSHVRKILGVKWDLGLFKNAYIPENIDPIAIVASHQDVALEAAHKS
IVLLKNDNNTLPLNPSSNTKIALIGPFADTINLGDYSGALGQYPAKYADTLRQGMLSHLK
KSGHSGAQISSSWGTNSWEYNNQYVVPGYLLSSNGKTGGLKATYYGETNFTSPKASRSEV
PAQDWGLYPPPGLSSNNFSAVWEGQFESPTDLDVNGWIGIAIGPNSTSKLYVDGKLITSK
GYGPQGNVIGNIQGYGWTQANHSIPPQDGVEFTFKKGAKHQVRIEFQSWNNYKKTANVNS
VNSQLIFWWNLVSPNGDALDQAVSVAKDSDVVVLAVGAAWNSDGEGGDRGTLDLAPSQDA
LAKKIYALGKPVILVLEGGRPFAIPDHYQQSSAVLSTFFGGQAGGQAISDVLFGTFNPGG
RVPITVPYSVAQVPAYYNYKPSARAAQYLDIPSDPTYPFGYGLSYTTFSTSSPTASVRGT
SSKRSNFDALASGQTFGGGDWITFSVTVENTGSVSGSYVAQIYLLGRVSTVTQPVKQLVG
FQRVYLDAGEKKSVSIKLEVDRYLMILNRANKWELEKGSYTFALLENGGSNADTSKSVTL
QCAG

Enzyme Prediction     

EC	3.2.1.37:15	3.2.1.55:3	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	119	343	1.2e-48	0.9537037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	5.34e-124	30	940	19	746	beta-glucosidase BglX.
178629	PLN03080	1.84e-59	131	944	89	768	Probable beta-xylosidase; Provisional
224389	BglX	6.86e-55	110	474	46	394	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	7.41e-42	603	825	24	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	2.13e-41	109	384	52	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ50349.1|GH3	0.0	1	964	1	964
QYS95490.1|GH3	0.0	1	964	1	960
BAP59016.1|GH3	0.0	1	964	1	949
UKZ67853.1|GH3	0.0	1	964	1	927
UKZ86638.1|GH3	0.0	150	964	1	810

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5TF0_A	1.52e-82	39	918	3	711	Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
5XXL_A	9.11e-82	42	923	7	719	Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	4.53e-81	42	923	7	719	Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5Z87_A	1.80e-79	7	918	5	745	Chain A, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
6R5I_A	1.41e-76	44	918	2	693	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q56078|BGLX_SALTY	2.91e-93	42	940	31	746	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|P33363|BGLX_ECOLI	4.04e-93	42	940	31	746	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
sp|T2KMH0|PLH24_FORAG	2.75e-79	124	960	65	720	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
sp|T2KMH9|PLH34_FORAG	1.51e-71	46	956	37	749	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
sp|Q23892|GLUA_DICDI	2.73e-61	45	940	76	807	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000639	0.999343	CS pos: 22-23. Pr: 0.9603

TMHMM  Annotations     

There is no transmembrane helices in TRIVIDRAFT_200353-t45_1-p1.