CAZyme Information: TRIVIDRAFT_196428-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_196428-t45_1-p1
• CAZy Family: CE3
• CAZyme Description: glycoside hydrolase family 16 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379	ABDF02000092|CGC7	41918.46	5.1779

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000092:1245071-1246971(+)

Full Sequence      

MRRPNGDQFTCISPQPLPNGDSACDCFLSNGTQPSYFSNHMFFDFRNLTKDAGVPALITN
ETLATIARPTSEYFSSDEWTSVWQLQGWSNSEGKGKSLSGAATVLMVNSPSNVYIQKNGD
DNAASDTYMALRTQRLPKFQTAAAFQTKTSDYQFVSLRMLARTTGGPGAVTAMFTYRDAT
STSSVQEADFEVLTRGPRERVQLTNQPSFNSNGQVNPDATRNVTLPDSMIWSQWAVYRLD
WTSQSSVWYVNGQQLANVTFQVPQEASGINFNAWSDGGSWSGNMSVYDQAGLQIQWIEMI
YNTSAQTPARRDPSRLWSRDTGPQGELLRRRDLSSRTSSDSCKVVCSIDEVAEAGVATML
WNSTATRIVASVAVTRYTI

Enzyme Prediction     

No EC number prediction in TRIVIDRAFT_196428-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	82	299	2.6e-89	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	2.29e-49	77	299	7	209	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
395585	Glyco_hydro_16	5.14e-06	136	297	17	167	Glycosyl hydrolases family 16.
185684	GH16_lichenase	1.02e-05	141	297	56	208	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
225182	BglS	2.19e-05	141	298	104	261	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
185693	GH16_laminarinase_like	0.003	212	283	138	216	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ51547.1|GH16_22	1.45e-279	1	379	1	379
UKZ77369.1|GH16_22	5.40e-237	41	369	1	329
QYS98274.1|GH16_22	8.62e-234	13	366	31	381
UKZ88547.1|GH16_22	2.28e-208	13	367	30	384
UKZ63659.1|GH16_22	2.21e-201	8	367	31	393

PDB Hits     

TRIVIDRAFT_196428-t45_1-p1 has no PDB hit.

Swiss-Prot Hits     

TRIVIDRAFT_196428-t45_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000060	0.000001

TMHMM  Annotations     

There is no transmembrane helices in TRIVIDRAFT_196428-t45_1-p1.