CAZyme Information: TRIVIDRAFT_192768-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_192768-t45_1-p1
• CAZy Family: CBM66
• CAZyme Description: glycoside hydrolase family 78 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
697		75772.29	4.3460

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000079:307476-309813(-)

Full Sequence      

MVSNTLFMLYAGLMLLGGVRAEKAETDKEARWHRFARSPVSKVVRPIGIVSDSTIGNVSN
PNGLIDRRSPTVLSRSNEDDLLPTVVVDFGQNMVGILSIEFSGSQNTSIGLPGLRLAFSE
TMEYLTNRSDFTRSDNASGDEKLTNGTDQVAVKDTNYIWTDLHGCEDSTKVCSDGLHGFR
YVKIRLEAIASDAPYTSSFGSVSISGLSLEWSAYLGSPDTFTGWFECSDDELTQWWYDGV
YTVDMGTDVFLANETEPRGASSPTLEGKQVLFDGAKRDRDPYVGDLAVAALTSYLSHDFA
ESTRNVLEDLALHQRDDGWIPPASIIDLVMYTGNTSYAETYWDTLIRVLDEYYPSNTNNA
TGLLDKTADMGYGDYAFLPRSGPVTYYNALYVHALSYASQLAESLGRDDDASRWSSRAAA
VGNALMSRNFDGSVGAFYDGGPCPGGGTGTLCNVHAQDGNAIAILAGVTDDKTSAEILDY
WQNATSQAYGNAFYDSSVLSPGDQFNYRVYAFISYFEIAARFATPGKASSAFDEIRRLYG
WMATHDPRITMWEGIGPNGTAYEGAFTSMAHGWSTGIVPLLTSYVLGVKPQTPGFQTWQI
CPVVDGGGLTWARGEVPTPGGKIGVSWERKDAQSGLMFVLETETLEGSSGIVCVPTLGLE
DPKIYMDGMPVTLSRDRIAGWMSVNVSGGKHTFTVES

Enzyme Prediction     

No EC number prediction in TRIVIDRAFT_192768-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	84	633	1.4e-76	0.9503968253968254

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	8.33e-15	222	435	3	219	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
379972	Bac_rhamnosid_C	2.65e-13	587	656	1	65	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
225942	GDB1	6.62e-04	324	421	347	453	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
336149	Bac_rhamnosid	7.34e-04	84	184	7	84	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ52996.1|GH78	0.0	1	697	1	697
UKZ78837.1|GH78	0.0	1	697	1	716
QYT03284.1|GH78	0.0	1	697	1	713
UKZ64081.1|GH78	0.0	1	697	1	712
UKZ97108.1|GH78	0.0	1	697	1	712

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	6.05e-15	218	630	297	679	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

TRIVIDRAFT_192768-t45_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000264	0.999729	CS pos: 21-22. Pr: 0.9793

TMHMM  Annotations     

There is no transmembrane helices in TRIVIDRAFT_192768-t45_1-p1.