CAZyme Information: TRIVIDRAFT_191530-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_191530-t45_1-p1
• CAZy Family: AA9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
499		56186.96	7.8651

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000006:2649029-2651006(-)

Full Sequence      

MWPFGSSYPERKPEDVDGKTYDYVIVGGGAAGCVLASRLSEDPNVSVLLLEKGVVNDNLL
SRIPLLSQNPMMDGLQAVKHLSQIPSALNRRLSLYWAEALGGSTRINAMLLTRGPPGNYN
EWSQEFGLKDWGWESVEPYFRKSENAIGHPDAEYRGHHGPVETRQPAYPFTCYPYIEIAV
RKLGLPVHNDCNDPASSAQGYFRLDQAIDSNGRRISAYKAWLSKETAIARTSHLTVCTGV
TASRLEVDTKTRKVIGVQIRRKGQADRREYYVQARREVVLCSGAIEIMVIPVESYFDVYI
TEHSLLTWLCTLVQPFSRGHIRLTTTNPEHPPEITHPLLRDDRDLEPMRKAIRFALRLGQ
EFGRSGYPHPAPLVYGPGMDLEYLDQRLGFTKPLPNQKKKSGGTTELPEWQNISDEAIDE
YTKRAYQSALHYACTCRMSLDAADGVVDQKLRVFGVNGLRIADASVFPKIPSAHTMAPTM
MVAERCADFIKETWREKRQ

Enzyme Prediction     

No EC number prediction in TRIVIDRAFT_191530-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	18	494	1.3e-74	0.5080906148867314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	2.68e-78	19	491	4	532	choline dehydrogenase; Validated
225186	BetA	9.59e-72	18	492	5	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.29e-38	315	486	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.26e-25	89	285	16	191	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	3.07e-12	6	482	38	568	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYS92880.1|AA3_2	0.0	1	497	1	618
UKZ47954.1|AA3	4.53e-308	8	499	1325	1919
QBZ58631.1|AA3_2	1.76e-129	2	499	3	661
VBB80495.1|AA3_2	3.11e-99	8	492	50	670
CDP28838.1|AA3_2	2.40e-98	9	492	51	670

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YS2_AAA	2.72e-35	16	487	3	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YRU_AAA	2.72e-35	16	487	3	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS1_AAA	2.72e-35	16	487	3	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
5NCC_A	3.12e-35	16	487	19	573	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]
7AV4_AAA	4.73e-35	16	487	79	633	Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q1QXE1|BETA1_CHRSD	1.02e-42	19	491	5	536	Oxygen-dependent choline dehydrogenase 1 OS=Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11) OX=290398 GN=betA1 PE=3 SV=1
sp|Q8D3K2|BETA_VIBVU	8.79e-41	21	490	5	530	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=betA PE=3 SV=1
sp|Q7MF12|BETA_VIBVY	2.28e-40	21	490	5	530	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=betA PE=3 SV=1
sp|Q9L4K0|BETA2_CHRSD	4.18e-40	21	491	7	534	Oxygen-dependent choline dehydrogenase OS=Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11) OX=290398 GN=betA PE=3 SV=1
sp|Q988C9|4PADH_RHILO	3.17e-39	19	490	5	533	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999997	0.000061

TMHMM  Annotations     

There is no transmembrane helices in TRIVIDRAFT_191530-t45_1-p1.