CAZyme Information: TRIVIDRAFT_169765-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_169765-t45_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1147		125079.20	6.7191

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000006:43669-47112(+)

Full Sequence      

MTTLDTLKQALRQNVTSPKQPLSDAQYSAGFDILLQGPGWKTYQDFIFPQLSQVLTPLFN
SRVRISVLEIGPGPKSVIGYMPDDQRRKIKKYAAFEPNGLYATKLQEWLGTKSSLPCLES
PPDIHRKPFALDSAVTAVNNGEEKFDVVLFCHSMYGMTPKRKFIERALEMLVVEPEGGLV
MVFHRDGLDFDGLTCHKTASFPSGIVRVADDDKILDSFASFIAGFVMQEEDADKAIHIEW
RKTCRNLGRRQESHPGHLLFSAPEVMVAFNHHSTMLPELTAQVPLVMKDKTVKNWEARLH
RAASIIRPTKVQHIQQCVQWALKHGVGLTVIGGGHSGHCLWPNVVAVDMDDFNQIYVQTP
GEDEKNPDSSSNSFIIAEAGCKTGDIIRTAMAVGLIVPLGARPSVGAGLWLQGGLGHLAR
LRGLACDSIVGVIMVSVDSAQILCIGHVPIQYWPTGGVRPENEAELLWAMKGAGTNFGIV
VSVIFKAYPAPTYTVRNWIVPLSGNVDAQRGLSEFDTFVARDLPRNCSADAYLYWDAGQL
HLGMTMIEAYTSGSTSETPTLVDTILGPEYSSKVVDAVGLFQTEMYVSGMHGGHGGGKTS
AFKRCLFLKDIGAAGMAENLVAAIESRPTALCYLHLLQGGGAVADVVPDATAFGCRDWDF
ACVVTGVWPRDQDGTQAARAAVQWVYDVARNLLPLSSGTYGADLGPDPRDAELAEKAFGP
NRQRLVRLKRGADPRKVLAYACPLPEASMEPKLIILVTGENCAGKDYCADVWASVFNRSS
PKTLTARVVSISDVTKQEYAVAAGADLNALLQDRAYKEQHRSALTAFFQDQVRQRPQLPQ
EHFMNVVNGAVGVDVLLITGMRDEAPVATLSHLVPESRVLEVRVETREETRRIRGGYQDG
GGVDHNKDHTNNTNGESVSTAPGWCPSLTFYNDTPGSEMAEVYGQRFLLPFFRKDLQQLA
NMVRSVPDFPRPGIEFRHVLGIAQQPGGLALCISLLRSHFTGDWNEINAVACCEAGGFIY
ASALATQMDLPLVLIREAGKLPPPVVSVIKRPSHISNSASNGSIEKKIEMERGVIHRGAS
VLVVDDVLATGETLCAVVQLLGEAGVSADRISAMVLAEFPLHRGRELMRRCGFGRVSIQS
LLVFRGA

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	300	540	7.4e-40	0.47161572052401746

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235028	PRK02304	1.87e-33	955	1146	2	175	adenine phosphoribosyltransferase; Provisional
273437	apt	1.59e-28	959	1144	1	169	adenine phosphoribosyltransferase. A phylogenetic analysis suggested omitting the bi-directional best hit homologs from the spirochetes from the seed for this model and making only tentative predictions of adenine phosphoribosyltransferase function for this lineage. The trusted cutoff score is made high for this reason. Most proteins scoring between the trusted and noise cutoffs are likely to act as adenine phosphotransferase. [Purines, pyrimidines, nucleosides, and nucleotides, Salvage of nucleosides and nucleotides]
223577	Apt	5.51e-28	956	1105	5	143	Adenine/guanine phosphoribosyltransferase or related PRPP-binding protein [Nucleotide transport and metabolism].
177930	PLN02293	3.92e-24	956	1126	14	171	adenine phosphoribosyltransferase
398111	P-mevalo_kinase	7.78e-24	757	875	1	111	Phosphomevalonate kinase. Phosphomevalonate kinase (EC:2.7.4.2) catalyzes the phosphorylation of 5-phosphomevalonate into 5-diphosphomevalonate, an essential step in isoprenoid biosynthesis via the mevalonate pathway. This family represents the animal type of the enzyme. The other is the ERG8 type, found in plants and fungi, and some bacteria (see pfam00288).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRC92907.1|AA7	1.50e-16	280	737	35	483
QRW22693.1|AA7	7.56e-15	299	741	58	479
UDD61931.1|AA7	9.01e-14	303	735	49	462
QPH04356.1|AA7	1.59e-13	272	737	80	540
UQC87672.1|AA7	3.07e-13	292	740	59	491

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FCH_A	4.96e-22	955	1126	3	164	Crystal Structure of Human APRT wild type in complex with PRPP and Mg2+ [Homo sapiens],6FCH_B Crystal Structure of Human APRT wild type in complex with PRPP and Mg2+ [Homo sapiens],6FCL_A Crystal Structure of Human APRT wild type in complex with AMP [Homo sapiens],6FCL_B Crystal Structure of Human APRT wild type in complex with AMP [Homo sapiens],6HGP_A Crystal Structure of Human APRT wild type in complex with Phosphate ion. [Homo sapiens],6HGP_B Crystal Structure of Human APRT wild type in complex with Phosphate ion. [Homo sapiens],6HGR_A Crystal Structure of Human APRT wild type in complex with IMP [Homo sapiens],6HGR_B Crystal Structure of Human APRT wild type in complex with IMP [Homo sapiens],6HGS_A Crystal Structure of Human APRT wild type in complex with GMP [Homo sapiens],6HGS_B Crystal Structure of Human APRT wild type in complex with GMP [Homo sapiens]
6FCI_A	5.09e-22	955	1126	4	165	Crystal Structure of Human APRT wild type in complex with Adenine, PRPP and Mg2+ [Homo sapiens],6FCI_B Crystal Structure of Human APRT wild type in complex with Adenine, PRPP and Mg2+ [Homo sapiens],6FCI_C Crystal Structure of Human APRT wild type in complex with Adenine, PRPP and Mg2+ [Homo sapiens],6FCI_D Crystal Structure of Human APRT wild type in complex with Adenine, PRPP and Mg2+ [Homo sapiens],6HGQ_A Crystal Structure of Human APRT wild type in complex with Hypoxanthine, PRPP and Mg2+ [Homo sapiens],6HGQ_B Crystal Structure of Human APRT wild type in complex with Hypoxanthine, PRPP and Mg2+ [Homo sapiens],6HGQ_C Crystal Structure of Human APRT wild type in complex with Hypoxanthine, PRPP and Mg2+ [Homo sapiens],6HGQ_D Crystal Structure of Human APRT wild type in complex with Hypoxanthine, PRPP and Mg2+ [Homo sapiens]
4X45_A	5.22e-22	955	1126	5	166	Crystal Structure of F173G Mutant of Human APRT [Homo sapiens],4X45_B Crystal Structure of F173G Mutant of Human APRT [Homo sapiens]
4X44_A	5.22e-22	955	1126	5	166	Crystal Structure of Mutant R89Q of human Adenine phosphoribosyltransferase [Homo sapiens]
1ORE_A	5.22e-22	955	1126	5	166	Human Adenine Phosphoribosyltransferase [Homo sapiens],1ZN7_A Human Adenine Phosphoribosyltransferase Complexed with PRPP, ADE and R5P [Homo sapiens],1ZN7_B Human Adenine Phosphoribosyltransferase Complexed with PRPP, ADE and R5P [Homo sapiens],1ZN8_A Human Adenine Phosphoribosyltransferase Complexed with AMP, in Space Group P1 at 1.76 A Resolution [Homo sapiens],1ZN8_B Human Adenine Phosphoribosyltransferase Complexed with AMP, in Space Group P1 at 1.76 A Resolution [Homo sapiens],1ZN9_A Human Adenine Phosphoribosyltransferase in Apo and AMP Complexed Forms [Homo sapiens],1ZN9_B Human Adenine Phosphoribosyltransferase in Apo and AMP Complexed Forms [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54H55|Y8969_DICDI	1.74e-26	305	734	51	437	FAD-linked oxidoreductase DDB_G0289697 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0289697 PE=2 SV=1
sp|P47952|APT_CRIGR	1.38e-25	955	1144	5	179	Adenine phosphoribosyltransferase OS=Cricetulus griseus OX=10029 GN=APRT PE=3 SV=2
sp|Q64414|APT_DIPCP	4.76e-25	955	1144	5	179	Adenine phosphoribosyltransferase OS=Dipodillus campestris OX=41199 GN=APRT PE=3 SV=1
sp|P36972|APT_RAT	1.04e-23	955	1144	5	179	Adenine phosphoribosyltransferase OS=Rattus norvegicus OX=10116 GN=Aprt PE=1 SV=1
sp|Q56JW4|APT_BOVIN	1.93e-23	955	1144	5	179	Adenine phosphoribosyltransferase OS=Bos taurus OX=9913 GN=APRT PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000042	0.000000

TMHMM  Annotations     

There is no transmembrane helices in TRIVIDRAFT_169765-t45_1-p1.