CAZyme Information: TRIVIDRAFT_151210-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_151210-t45_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
586		64639.91	5.4674

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000030:6579-8406(+)

Full Sequence      

MKTDSEAKYDFIIVGAGPAGCSLASHLAASPAKPSVLLLEAGGDNSDINARVGVNRFIQI
ANPELTYPYESVPQYHLGGRALKLERGRGLGGSSCINFTLWDVGARDDWEKIAQLTGDNM
WNWQNVQKRFRELEDFHGKVPEDVPPNMEKYVCPKSQNHGSGGLLRTAMSSSWESFTIPV
LETWESNGYTINKDASSGDRLGMSIGSTTCFRGTRSTASDLLLGAPPNLQVVTNAIAHRV
LFEDSRAVGVVLVDEKVYRANHEVILSAGTLDTPKILMHSGIGSDSQLSSFGIPLVHQNP
HVGRNYMDHYFSTLRFRQSDGLDSVMPYFRSPVLQAKAMKQWQLYRDGECTTTASSALYG
FFKSDAVMKSREYADLPTVEQARLRLPTIPTYEIAFSSIGPECYTAPDTTPPIINVLVVI
HNSQGLGHVELKSKDPTAPLEFHPACLTHPYDQRVAIEATREVLKVIKTGNFLQEGASNA
SQWDTPATDDEEDILKWWRERCGTTWHMSGTCKMAQTEDEGGVVDSDFRVFGVNGLRVVD
MSIMPIMLSAHTQAAAYQVGMIAAEKLIKEYDLLVQESEVNYNSQG

Enzyme Prediction     

No EC number prediction in TRIVIDRAFT_151210-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	8	569	1.2e-142	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	2.37e-80	2	576	1	542	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	9.37e-74	8	566	5	526	choline dehydrogenase; Validated
215420	PLN02785	4.84e-38	9	570	56	579	Protein HOTHEAD
398739	GMC_oxred_C	2.28e-34	427	564	5	141	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	5.85e-23	78	310	15	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK95388.1|AA3_2	9.61e-223	5	573	4	571
QBZ66107.1|AA3_2	1.76e-176	4	580	3	584
CEI63764.1|AA3_2	2.40e-158	7	573	4	564
QPC74670.1|AA3_2	6.79e-158	5	573	2	564
QPC65891.1|AA3_2	7.70e-157	5	573	2	564

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FIM_B	1.09e-48	7	569	1	563	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
5OC1_A	3.84e-48	9	569	2	562	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3Q9T_A	3.62e-45	9	571	7	573	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	4.96e-45	9	571	7	573	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	6.80e-45	9	571	7	573	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9WWW2|ALKJ_PSEPU	2.25e-56	9	586	2	546	Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida OX=303 GN=alkJ PE=3 SV=1
sp|Q00593|ALKJ_PSEOL	1.70e-53	9	586	2	546	Alcohol dehydrogenase [acceptor] OS=Pseudomonas oleovorans OX=301 GN=alkJ PE=1 SV=1
sp|A7MFA8|BETA_CROS8	5.59e-50	8	567	2	531	Oxygen-dependent choline dehydrogenase OS=Cronobacter sakazakii (strain ATCC BAA-894) OX=290339 GN=betA PE=3 SV=1
sp|Q985M5|BETA_RHILO	6.29e-49	10	579	5	538	Oxygen-dependent choline dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=betA PE=3 SV=1
sp|B7M2V5|BETA_ECO8A	6.95e-49	8	560	2	524	Oxygen-dependent choline dehydrogenase OS=Escherichia coli O8 (strain IAI1) OX=585034 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000033	0.000022

TMHMM  Annotations     

There is no transmembrane helices in TRIVIDRAFT_151210-t45_1-p1.