CAZyme Information: TRIVIDRAFT_150816-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_150816-t45_1-p1
• CAZy Family: PL38
• CAZyme Description: glycosyltransferase family 1 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
482		53667.60	8.3968

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000006:2297637-2299297(+)

Full Sequence      

MAPFFPKRILLITNIECGELDVFVATAQSLLEADPNLDLHLATFQGLPDDALPTGVTYHT
IKGLSMYQALEEHLNRAQRDGVVTKPARNAGFAKTRSAIRAFASLMMPYTGRQMVDVFTS
IVDIIRNLNADLVVVDSLMSAGLTACYHLEVKFICLGPNSIKEFAAAEQPHKAGLWKFPA
LFSGFDYPVPWSKIPLNIHFTWYLYKAIKNDPQRKEVQSYLTAHTVLRSPVDLVKNRPEG
VKILVSSLPQLDFPLKIPPHVVPCGPILRRSEPLVDTNPKLAEWLAQGRTIYINLGALFK
VSEGQAVEMAKALKIVINSIEKDDEKGPIQVLWKLKKKGRYSVYEPTCILSRILRHEFAL
DRVRVMDWIQAEPISILNTGSVVCSVHHGGANSFNEAIVVLPVWGVCYDYAQRVERLGVG
LCGNRIYKPRWAAEELSHKLLEVLVGDKSEEMKQKAIAVMMACKYTGSGADCAASVILSE
CR

Enzyme Prediction     

No EC number prediction in TRIVIDRAFT_150816-t45_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	4.72e-22	112	470	83	395	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	5.57e-11	6	460	1	379	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
178170	PLN02555	8.14e-10	208	456	182	439	limonoid glucosyltransferase
215127	PLN02210	6.51e-05	283	403	261	365	UDP-glucosyl transferase
215112	PLN02167	0.001	231	398	207	375	UDP-glycosyltransferase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ47850.1|GT1	0.0	1	482	1	482
UKZ74408.1|GT1	0.0	1	482	1	488
QYS93006.1|GT1	3.81e-267	1	482	1	489
UKZ84460.1|GT1	7.43e-203	1	482	1	488
UKZ60968.1|GT1	3.14e-200	6	482	5	487

PDB Hits     

TRIVIDRAFT_150816-t45_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A411KZY6|BUAB_ASPBU	4.27e-60	9	467	8	468	Glycosyltransferase buaB OS=Aspergillus burnettii OX=2508778 GN=buaB PE=3 SV=1
sp|A0A1B4XBH6|SDNJ_SORAA	2.91e-55	9	425	8	434	Glycosyltransferase sdnJ OS=Sordaria araneosa OX=573841 GN=sdnJ PE=1 SV=1
sp|Q5XF20|U84A1_ARATH	3.01e-09	207	457	191	451	UDP-glycosyltransferase 84A1 OS=Arabidopsis thaliana OX=3702 GN=UGT84A1 PE=1 SV=1
sp|A0A0D1DZV5|EMT1_USTMA	5.41e-07	351	480	429	561	Erythritol-mannosyl-transferase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=EMT1 PE=1 SV=1
sp|M9MH90|EMT1_PSEA3	5.01e-06	351	456	430	539	Erythritol-mannosyl-transferase 1 OS=Pseudozyma antarctica (strain T-34) OX=1151754 GN=EMT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000031	0.000007

TMHMM  Annotations     

There is no transmembrane helices in TRIVIDRAFT_150816-t45_1-p1.